RNF11 Polyclonal antibody

• 

  WB analysis of mouse brain using 16948-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 16948-1-AP (RNF11 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 16948-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 16948-1-AP (RNF11 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 16948-1-AP

  IP result of anti-RNF11 (IP:16948-1-AP, 4ug; Detection:16948-1-AP 1:300) with mouse brain tissue lysate 4000ug.

RNF11 Polyclonal Antibody for WB, IP, ELISA

Cat No. 16948-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IF, ELISA

Synonyms

CGI 123, ring finger protein 11, RNF11, SID1669

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IP detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

16948-1-AP targets RNF11 in WB, IP, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10563

  Product name: Recombinant human RNF11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-154 aa of BC020964

  Sequence: MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN

• Full Name: ring finger protein 11
• Calculated Molecular Weight: 154 aa, 17 kDa
• GenBank Accession Number: BC020964
• Gene Symbol: RNF11
• Gene ID (NCBI): 26994
• RRID: AB_2878335
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y3C5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Sci Adv; The Arp1/11 minifilament of dynactin primes the endosomal Arp2/3 complex.; Authors - Artem I Fokin
human		Cancer Res; A20/TNFAIP3 Regulates the DNA Damage Response and Mediates Tumor Cell Resistance to DNA-Damaging Therapy.; Authors - Chuanzhen Yang