RNF183 Polyclonal antibody

• 

  WB analysis using 32715-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32715-1-AP (RNF183 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

RNF183 Polyclonal Antibody for WB, ELISA

Cat No. 32715-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

E3 ubiquitin-protein ligase RNF183, EC:2.3.2.27

---

Tested Applications

• Positive WB detected in: 5637 cells, HCT 116 cells, HT-29 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32715-1-AP targets RNF183 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36228

  Product name: Recombinant human RNF183 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-161 aa of BC013036

  Sequence: MAEQQGRELEAECPVCWNPFNNTFHTPKMLDCCHSFCVECLAHLSLVTPARRRLLCPLCRQPTVLASGQPVTDLPTDTAMLTLLRLEPHHVILEGHQLCLKDQPKSRYFLRQPRVYTLDLGPQPGGQTGPPPDTASATVSTPILIPSHHSLRECFRNPQFR

• Full Name: ring finger protein 183
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC013036
• Gene Symbol: RNF183
• Gene ID (NCBI): 138065
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96D59
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RNF183, or Ring Finger Protein 183, is a member of the RING finger protein family that functions as a ubiquitin ligase. RNF183 exhibits tissue-specific expression patterns, with higher expression levels in the gall bladder, kidney, and other tissues. RNF183 expression levels are increased in patients with IBD, including Crohn's disease and ulcerative colitis (PMID: 32486221). It promotes intestinal inflammation by increasing the ubiquitination and degradation of IkappaBalpha, thereby inducing NF-kappaB activation (PMID: 31889078). RNF183 has also been implicated in other conditions such as chronic kidney disease and Alzheimer's disease.