Anti-Mouse RON/MST1R Rabbit Recombinant Antibody

• 

  FC experiment of mouse peritoneal macrophages using 98587-2-RR

  1x10^6 mouse peritoneal macrophages were surface stained with 0.25 ug Anti-Mouse RON/MST1R Rabbit RecAb (98587-2-RR, Clone: 250364F1) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-conjugated Goat Anti-Rabbit IgG. Cells were co-stained with CoraLite® Plus 750 Anti-Mouse F4/80. Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

• 

  FC experiment of mouse peritoneal macrophages using 98587-2-RR

  1x10^6 mouse peritoneal macrophages were surface stained with 0.25 ug Anti-Mouse RON/MST1R Rabbit RecAb (98587-2-RR, Clone: 250364F1) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-conjugated Goat Anti-Rabbit IgG. Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

RON/MST1R Uni-rAb^® Recombinant Antibody for FC

Cat No. 98587-2-RR

Clone No.250364F1

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD136, EC:2.7.10.1, Macrophage-stimulating protein receptor, Macrophage-stimulating protein receptor alpha chain, Macrophage-stimulating protein receptor beta chain

---

Tested Applications

• Positive FC detected in: mouse peritoneal macrophages

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98587-2-RR targets RON/MST1R in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2647

  Product name: Recombinant Mouse MST1R protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 25-960 aa of NM_009074.2

  Sequence: TNLNWQCPRIPYAASRDFSVKYVVPSFSAGGRVQATAAYEDSTNSAVFVATRNHLHVLGPDLQFIENLTTGPIGNPGCQTCASCGPGPHGPPKDTDTLVLVMEPGLPALVSCGSTLQGRCFLHELEPRGKALHLAAPACLFSANNNKPEACTDCVASPLGTRVTVVEQGHASYFYVASSLDPELAASFSPRSVSIRRLKSDTSGFQPGFPSLSVLPKYLASYLIKYVYSFHSGDFVYFLTVQPISVTSPPSALHTRLVRLNAVEPEIGDYRELVLDCHFAPKRRRRGAPEGTQPYPVLQAAHSAPVDAKLAVELSISEGQEVLFGVFVTVKDGGSGMGPNSVVCAFPIYHLNILIEEGVEYCCHSSNSSSLLSRGLDFFQTPSFCPNPPGGEASGPSSRCHYFPLMVHASFTRVDLFNGLLGSVKVTALHVTRLGNVTVAHMGTVDGRVLQVEIARSLNYLLYVSNFSLGSSGQPVHRDVSRLGNDLLFASGDQVFKVPIQGPGCRHFLTCWRCLRAQRFMGCGWCGDRCDRQKECPGSWQQDHCPPEISEFYPHSGPLRGTTRLTLCGSNFYLRPDDVVPEGTHQITVGQSPCRLLPKDSSSPRPGSLKEFIQELECELEPLVTQAVGTTNISLVITNMPAGKHFRVEGISVQEGFSFVEPVLTSIKPDFGPRAGGTYLTLEGQSLSVGTSRAVLVNGTQCRLEQVNEEQILCVTPPGAGTARVPLHLQIGGAEVPGSWTFHYKEDPIVLDISPKCGYSGSHIMIHGQHLTSAWHFTLSFHDGQSTVESRCAGQFVEQQQRRCRLPEYVVRNPQGWATGNLSVWGDGAAGFTLPGFRFLPPPSPLRAGLVELKPEEHSVKVEYVGLGAVADCVTVNMTVGGEVCQHELRGDVVICPLPPSLQLGKDGVPLQVCVDGGCHILSQVVRSSPGRASQR

• Full Name: macrophage stimulating 1 receptor (c-met-related tyrosine kinase)
• Calculated Molecular Weight: 151 kDa
• GenBank Accession Number: NM_009074.2
• Gene Symbol: Mst1r
• Gene ID (NCBI): 19882
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q62190-1
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

RON (also referred to as MST1R, or CD136) is a receptor tyrosine kinase that belongs to the MET proto-oncogene family. The precursor RON is produced as a glycosylated, single chain that is cleaved into a 185-kDa heterodimer of α (35 kDa) and β (150 kDa) subunits connected by a disulfide bond (PMID: 8062829). It is activated upon binding to its ligand, macrophage-stimulating protein (MSP, also known as MST1 and HGFL). RON signalling is essential for embryonic development and regulates many physiological processes including cell survival, migration and differentiation.