CoraLite® Plus 488-conjugated ROR2 Monoclonal antibody

ROR2 Monoclonal Antibody for
Cat No. CL488-67906
Clone No.1A12C5

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

Tyrosine-protein kinase transmembrane receptor ROR2, NTRKR2, Neurotrophic tyrosine kinase, receptor-related 2, EC:2.7.10.1, BDB1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-67906 targets ROR2 in applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag31197

Product name: Recombinant human ROR2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 781-943 aa of BC130522

Sequence: VSNARYVGPKQKAPPFPQPQFIPMKGQIRPMVPPPQLYIPVNGYQPVPAYGAYLPNFYPVQIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSMADRAALLSEGADDTQNAPEDGAQSTVQEAEEEEEGSVPETELLGDCDTLQVDEAQVQLEA

Predict reactive species
Full Name receptor tyrosine kinase-like orphan receptor 2
Calculated Molecular Weight 943 aa, 105 kDa
Observed Molecular Weight105 kDa
GenBank Accession NumberBC130522
Gene Symbol ROR2
Gene ID (NCBI) 4920
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ01974
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Tyrosine-protein kinase transmembrane receptor ROR2 belongs to the ROR-family of receptor tyrosine kinases (RTKs) (PMID: 12815588). ROR2 is a developmentally regulated protein that has significant expression and roles in a wide variety of tissues during early embryonic development. It was established that ROR2 plays a key role in skeletal and neural organogenesis, as well as in midgut development in the mouse, but then becomes repressed in adult tissues. It may act as a receptor for wnt ligand WNT5A which may result in the inhibition of WNT3A-mediated signaling (PMID: 25614331). Mutations in ROR2 gene are associated with autosomal recessive Robinow syndrome and autosomal dominant brachydactyly type B (PMID: 12815588).

Loading...
||
New chat

Able

正在加载,请稍候...