RPAP1 Monoclonal antibody

RPAP1 Monoclonal Antibody for WB, ELISA, FC (Intra)
Cat No. 68193-1-Ig
Clone No.2A6H5

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

WB, ELISA, FC (Intra)

RPAP 1, RNA polymerase II-associated protein 1, KIAA1403, 2A6H5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, mouse brain tissue, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, rat brain tissue
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68193-1-Ig targets RPAP1 in WB, ELISA, FC (Intra) applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7856

Product name: Recombinant human RPAP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-351 aa of BC000246

Sequence: MLSRPKPGESEVDLLHFQSQFLAAGAAPAVQLVKKGNRGGGDANSDRPPLQDHRDVVMLDNLPDLPPALVPSPPKRARPSPGHCLPEDEDPEERLRRHDQHITAVLTKIIERDTSSVAVNLPVPSGVAFPAVFLRSRDTQGKSATSGKRSIFAQEIAARRIAEAKGPSVGEVVPNVGPPEGAVTCETPTPRNQGCQLPGSSHSFQGPNLVTGKGLRDQEAEQEAQTIHEENIARLQAMAPEEILQEQQRLLAQLDPSLVAFLRSHSHTQEQTGETASEEQRPGGPSANVTKEEPLMSAFASEPRKRDKLEPEAPALALPVTPQKEWLHMDTVELEKLHWTQDLPPVRRQQT

Predict reactive species
Full Name RNA polymerase II associated protein 1
Calculated Molecular Weight 153 kDa
Observed Molecular Weight 153 kDa
GenBank Accession NumberBC000246
Gene Symbol RPAP1
Gene ID (NCBI) 26015
RRIDAB_2935282
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9BWH6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RNA polymerase II-associated protein 1 (RPAP1) encodes a nuclear 153-kDa protein, and forms an interface between the RNA polymerase II (RNAPII) enzyme and chaperone/scaffolding protein, suggesting that it is required to connect RNA polymerase II to regulators of protein complex formation. RPAP1 is required for interaction of the RNA polymerase II complex with acetylated histone H3 and the subsequent DNA transcription.

Protocols

Product Specific Protocols
WB protocol for RPAP1 antibody 68193-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...