RPH3A Polyclonal antibody

• 

  WB analysis of COLO 320 using 11396-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 11396-1-AP (RPH3A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 11396-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 11396-1-AP (RPH3A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 11396-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11396-1-AP (RPH3A antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 11396-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11396-1-AP (RPH3A antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of SH-SY5Y using 11396-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using RPH3A antibody (11396-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

RPH3A Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11396-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Rabphilin 3A, Rabphilin, KIAA0985, Exophilin-1, Exophilin1

---

Tested Applications

• Positive WB detected in: COLO 320 cells, human brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below
• IF: See 1 publications below

Product Information

11396-1-AP targets RPH3A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1956

  Product name: Recombinant human RPH3A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC017259

  Sequence: MTDTVFSNSSNRWMYPSDRPLQSKLQAGWSVHPGGQPDRQRKQEELTDEEKEIINRVIARAEKMEEMEQERIGRLVDRLENMRKNVAGDGVNRCILCGEQLGMLGSACVVCEDCKKNVCTKCGVETNNRLHSVWLCKICIEQREVWKRSGAWFFKGFPKQVLPQPMPIKKTKPQQPVSEPAAPEQPAPEPKHPARAPARGDSEDRRGPGQKTGPDPASAPGRGNYGPPVRRASEARMSSSSRDSESWDHSGGAGDSSRSPAGLRRANSVQASRPAPGSVQSPAPPQPGQPGTPGGSRPGP

• Full Name: rabphilin 3A homolog (mouse)
• Calculated Molecular Weight: 690 aa, 76 kDa
• Observed Molecular Weight: 76 kDa
• GenBank Accession Number: BC017259
• Gene Symbol: RPH3A
• Gene ID (NCBI): 22895
• RRID: AB_2181145
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2J0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAB3A is a small G protein that is thought to act in exocytosis of neurotransmitters and hormones in synaptic neurotransmission and cell-cell communication. RPH3A (RPH3A), a RAB3A effector, is a neuronal C2 domain tandem containing protein that is involved in the neuronal transmitter process. Huntington's disease (HD) is a hereditary neurodegenerative disorder characterized by progressive motor disturbances, cognitive defects and dementia. Level of rabphilin 3A is substantially decreased in synapses of most brain regions in R6/1 transgenic mouse model of HD suggesting a role of RPH3A in impaired synaptic transmission.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; Integrative omics indicate FMRP sequesters mRNA from translation and deadenylation in human neuronal cells; Authors - Tatsuaki Kurosaki
mouse	WB	Front Aging Neurosci; Detrimental effects of soluble α-synuclein oligomers at excitatory glutamatergic synapses; Authors - Elena Ferrari
mouse	WB	Sci Rep; Multiple Transcriptomic Analyses Explore Potential Synaptic Biomarker Rabphilin-3A for Alzheimer's Disease; Authors - Doan Phuong Quy Nguyen
rat	WB	Br J Pharmacol; Memantine-induced functional rewiring of the glutamate synapse in the striatum of dopamine transporter knockout rats; Authors - Lucia Caffino
mouse	WB,IF	Pharmacol Res; Rabphilin-3A as a novel target to reverse α-synuclein-induced synaptic loss in Parkinson's disease; Authors - Elena Ferrari
rat	WB	Elife; Rabphilin 3A binds the N-peptide of SNAP-25 to promote SNARE complex assembly in exocytosis; Authors - Tianzhi Li