RPL3 Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 11005-1-AP (same clone as 11005-1-PBS)

  WB result of RPL3 antibody (11005-1-AP, 1:2000) with si-control and si-RPL3 transfected HeLa cells.. This data was developed using the same antibody clone with 11005-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 11005-1-AP (same clone as 11005-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11005-1-AP (RPL3 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11005-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human kidney using 11005-1-AP (same clone as 11005-1-PBS)

  human kidney tissue were subjected to SDS PAGE followed by western blot with 11005-1-AP (RPL3 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11005-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 11005-1-AP (same clone as 11005-1-PBS)

  IP result of anti-RPL3 (IP:11005-1-AP, 4ug; Detection:11005-1-AP 1:10000) with HepG2 cells lysate 1480 ug. This data was developed using the same antibody clone with 11005-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 11005-1-AP (same clone as 11005-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11005-1-AP (RPL3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11005-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 11005-1-AP (same clone as 11005-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11005-1-AP (RPL3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11005-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 11005-1-AP (same clone as 11005-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using RPL3 antibody (11005-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 11005-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RPL3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 11005-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

60S ribosomal protein L3, HIV-1 TAR RNA-binding protein B, Large ribosomal subunit protein uL3, OK/SW-cl.32, ribosomal protein L3

---

Product Information

11005-1-PBS targets RPL3 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1436

  Product name: Recombinant human RPL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 153-403 aa of BC012786

  Sequence: MKKYCQVIRVIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLKKDRIAKEEGA

• Full Name: ribosomal protein L3
• Calculated Molecular Weight: 46/27 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC012786
• Gene Symbol: RPL3
• Gene ID (NCBI): 6122
• RRID: AB_2181760
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P39023
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL3, also named as TARBP-B and MGC104284, belongs to the ribosomal protein L3P family. This protein is a component of the 60S subunit. It can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. This is a rabbit polyclonal antibody raised against the C terminus of human RPL3.