Tested Applications
Positive WB detected in | Jurkat cells, human kidney tissue, HeLa cells, Raji cells, human placenta tissue, mouse kidney tissue |
Positive IP detected in | HepG2 cells |
Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:16000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 12 publications below |
IHC | See 2 publications below |
IF | See 3 publications below |
Product Information
11005-1-AP targets RPL3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag1436 Product name: Recombinant human RPL3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 153-403 aa of BC012786 Sequence: MKKYCQVIRVIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLKKDRIAKEEGA Predict reactive species |
Full Name | ribosomal protein L3 |
Calculated Molecular Weight | 46/27 kDa |
Observed Molecular Weight | 46 kDa |
GenBank Accession Number | BC012786 |
Gene Symbol | RPL3 |
Gene ID (NCBI) | 6122 |
RRID | AB_2181760 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P39023 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL3, also named as TARBP-B and MGC104284, belongs to the ribosomal protein L3P family. This protein is a component of the 60S subunit. It can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. This is a rabbit polyclonal antibody raised against the C terminus of human RPL3.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RPL3 antibody 11005-1-AP | Download protocol |
IHC protocol for RPL3 antibody 11005-1-AP | Download protocol |
IF protocol for RPL3 antibody 11005-1-AP | Download protocol |
IP protocol for RPL3 antibody 11005-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Proc Natl Acad Sci U S A Preventing translational inhibition from ribosomal protein insufficiency by a herpes simplex virus-encoded ribosome-associated protein.
| ||
Elife METTL18-mediated histidine methylation of RPL3 modulates translation elongation for proteostasis maintenance. | ||
Aging (Albany NY) RNA-seq analysis of the key long noncoding RNAs and mRNAs related to cognitive impairment after cardiac arrest and cardiopulmonary resuscitation. | ||
Nucleic Acid Ther Knockdown of Muscle-Specific Ribosomal Protein L3-Like Enhances Muscle Function in Healthy and Dystrophic Mice. | ||
Life Sci Alliance Rapid ER remodeling induced by a peptide-lipid complex in dying tumor cells |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Sharvani (Verified Customer) (06-06-2025) | The antibody was used on whole cell lysates of mouse bone marrow derived macrophages. The signal was very clean with no background bands.
|
FH Abe (Verified Customer) (04-25-2024) | Worked well for IF at 1:500 overnight at 4c in RPE-1 cells.
|