• Featured Product
  • KD/KO Validated

RPL3 Polyclonal antibody

RPL3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 11005-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

60S ribosomal protein L3, HIV-1 TAR RNA-binding protein B, Large ribosomal subunit protein uL3, OK/SW-cl.32, ribosomal protein L3

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, human kidney tissue, HeLa cells, Raji cells, human placenta tissue, mouse kidney tissue
Positive IP detected inHepG2 cells
Positive IHC detected inhuman prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11005-1-AP targets RPL3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1436

Product name: Recombinant human RPL3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 153-403 aa of BC012786

Sequence: MKKYCQVIRVIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLKKDRIAKEEGA

Predict reactive species
Full Name ribosomal protein L3
Calculated Molecular Weight 46/27 kDa
Observed Molecular Weight 46 kDa
GenBank Accession NumberBC012786
Gene Symbol RPL3
Gene ID (NCBI) 6122
RRIDAB_2181760
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP39023
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL3, also named as TARBP-B and MGC104284, belongs to the ribosomal protein L3P family. This protein is a component of the 60S subunit. It can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. This is a rabbit polyclonal antibody raised against the C terminus of human RPL3.

Protocols

Product Specific Protocols
WB protocol for RPL3 antibody 11005-1-APDownload protocol
IHC protocol for RPL3 antibody 11005-1-APDownload protocol
IF protocol for RPL3 antibody 11005-1-APDownload protocol
IP protocol for RPL3 antibody 11005-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Proc Natl Acad Sci U S A

Preventing translational inhibition from ribosomal protein insufficiency by a herpes simplex virus-encoded ribosome-associated protein.

Authors - Elizabeth I Vink
  • KD Validated
humanWB

Elife

METTL18-mediated histidine methylation of RPL3 modulates translation elongation for proteostasis maintenance.

Authors - Eriko Matsuura-Suzuki
humanWB

Cell Discov

Ribosomal RNA regulates chromosome clustering during mitosis.

Authors - Kai Ma
mouseWB

Aging (Albany NY)

RNA-seq analysis of the key long noncoding RNAs and mRNAs related to cognitive impairment after cardiac arrest and cardiopulmonary resuscitation.

Authors - Chan Chen
humanWB

Nucleic Acid Ther

Knockdown of Muscle-Specific Ribosomal Protein L3-Like Enhances Muscle Function in Healthy and Dystrophic Mice.

Authors - Betty R Kao
humanIF

Life Sci Alliance

Rapid ER remodeling induced by a peptide-lipid complex in dying tumor cells

Authors - Samudra Sabari

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Sharvani (Verified Customer) (06-06-2025)

The antibody was used on whole cell lysates of mouse bone marrow derived macrophages. The signal was very clean with no background bands.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: Mouse bone marrow derived macrophages
FH

Abe (Verified Customer) (04-25-2024)

Worked well for IF at 1:500 overnight at 4c in RPE-1 cells.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: RPE-1
Loading...
||
New chat Able
正在加载,请稍候...