RPL39L Polyclonal antibody, PBS Only

• 

  WB analysis of HL-60 using 24940-1-AP (same clone as 24940-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 24940-1-AP (RPL39L Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24940-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 24940-1-AP (same clone as 24940-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 24940-1-AP (RPL39L antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24940-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 24940-1-AP (same clone as 24940-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 24940-1-AP (RPL39L antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24940-1-PBS in a different storage buffer formulation.

RPL39L Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24940-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

60S ribosomal protein L39-2, 60S ribosomal protein L39-like, Large ribosomal subunit protein eL39-like, Ribosomal protein eL39-like 2, RPL39L1

---

Product Information

24940-1-PBS targets RPL39L in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20923

  Product name: Recombinant human RPL39L protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-51 aa of BC012328

  Sequence: MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL

• Full Name: ribosomal protein L39-like
• Calculated Molecular Weight: 51 aa, 6 kDa
• Observed Molecular Weight: 6 kDa
• GenBank Accession Number: BC012328
• Gene Symbol: RPL39L
• Gene ID (NCBI): 116832
• RRID: AB_2879810
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96EH5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.