Product Information
24940-1-PBS targets RPL39L in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag20923 Product name: Recombinant human RPL39L protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-51 aa of BC012328 Sequence: MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL Predict reactive species |
Full Name | ribosomal protein L39-like |
Calculated Molecular Weight | 51 aa, 6 kDa |
Observed Molecular Weight | 6 kDa |
GenBank Accession Number | BC012328 |
Gene Symbol | RPL39L |
Gene ID (NCBI) | 116832 |
RRID | AB_2879810 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96EH5 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |