RPS19BP1 Polyclonal antibody, PBS Only

• 

  WB analysis using 14319-1-AP (same clone as 14319-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 14319-1-AP (RPS19BP1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14319-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 14319-1-AP (same clone as 14319-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 14319-1-AP (RPS19BP1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14319-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 14319-1-AP (same clone as 14319-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 14319-1-AP (RPS19BP1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14319-1-PBS in a different storage buffer formulation.

RPS19BP1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 14319-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

14319-1-PBS targets RPS19BP1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5560

  Product name: Recombinant human RPS19BP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-136 aa of BC047711

  Sequence: MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS

• Full Name: ribosomal protein S19 binding protein 1
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC047711
• Gene Symbol: RPS19BP1
• Gene ID (NCBI): 91582
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86WX3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RPS19BP1, also named as AROS and S19BP, is recently described as direct negative and positive regulators of SIRT1 activity. It enhances SIRT1-mediated deacetylation of p53/TP53, thereby participating in inhibition of p53/TP53-mediated transcriptional activity.