Tested Applications
| Positive WB detected in | NIH/3T3 cells, HeLa cells, MCF-7 cells, MDA-MB-231 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human lung cancer tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 3 publications below |
| IHC | See 2 publications below |
| CoIP | See 1 publications below |
Product Information
14446-1-AP targets RSK3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5862 Product name: Recombinant human RPS6KA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 66-311 aa of BC002363 Sequence: GQGSYGKVFLVRKVKGSDAGQLYAMKVLKKATLKVRDRVRSKMERDILAEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKITDFGLSKEAIDHDKRAYSFCGTIEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGSLPFQGKDRKETMALILKAKLGMPQFLSGEAQSLLRALFKRNPCNRLGAGIDGVEE Predict reactive species |
| Full Name | ribosomal protein S6 kinase, 90kDa, polypeptide 2 |
| Calculated Molecular Weight | 83 kDa |
| Observed Molecular Weight | 83 kDa |
| GenBank Accession Number | BC002363 |
| Gene Symbol | RSK3 |
| Gene ID (NCBI) | 6196 |
| RRID | AB_2285316 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15349 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RSK3, also named as RPS6KA2, belongs to the protein kinase superfamily. RSK3 is a serine/threonine-protein kinase that acts downstream of ERK (MAPK1/ERK2 and MAPK3/ERK1) signaling and mediates mitogenic and stress-induced activation of transcription factors, regulates translation, and mediates cellular proliferation, survival, and differentiation. In addition RSK3 may function as tumor suppressor in epithelial ovarian cancer cells(Uniprot). The molecular weight of RSK3 is 83 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RSK3 antibody 14446-1-AP | Download protocol |
| IHC protocol for RSK3 antibody 14446-1-AP | Download protocol |
| IP protocol for RSK3 antibody 14446-1-AP | Download protocol |
| WB protocol for RSK3 antibody 14446-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Theranostics Kartogenin hydrolysis product 4-aminobiphenyl distributes to cartilage and mediates cartilage regeneration. | ||
Theranostics RSK-3 promotes cartilage regeneration via interacting with rpS6 in cartilage stem/progenitor cells.
| ||
Epigenomics Multiomics analysis identifies key genes and pathways related to N6-methyladenosine RNA modification in ovarian cancer. | ||
Cell Death Discov MYSM1 induces apoptosis and sensitizes TNBC cells to cisplatin via RSK3-phospho-BAD pathway. | ||
J Med Chem Discovery, Optimization, and Structure-Activity Relationship Study of Novel and Potent RSK4 Inhibitors as Promising Agents for the Treatment of Esophageal Squamous Cell Carcinoma |





















