Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

RSK2 Polyclonal antibody

RSK2 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Cat No. 23762-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA

RPS6KA3, CLS, EC:2.7.11.1, HU 3, Insulin-stimulated protein kinase 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNIH/3T3 cells, K-562 cells, MCF-7 cells, HepG2 cells
Positive IP detected inK-562 cells
Positive IHC detected inhuman kidney tissue, mouse colon tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse skeletal muscle tissue, mouse brain tissue
Positive IF/ICC detected inHepG2 cells, HUVEC cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:5000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

23762-1-AP targets RSK2 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20620

Product name: Recombinant human RPS6KA3 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 666-740 aa of BC096301

Sequence: QRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVKGAMAATYSALNRNQSPVLEPVGRSTLAQRRGIKKITSTAL

Predict reactive species
Full Name ribosomal protein S6 kinase, 90kDa, polypeptide 3
Calculated Molecular Weight 740 aa, 84 kDa
Observed Molecular Weight 84 kDa
GenBank Accession NumberBC096301
Gene Symbol RSK2
Gene ID (NCBI) 6197
RRIDAB_2879318
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP51812
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RPS6KA3(Ribosomal protein S6 kinase alpha-3) is also named as ISPK1, MAPKAPK1B, RSK2 and belongs to the protein kinase superfamily. It localizes at the kinetochores under spindle checkpoint conditions, and during mitosis, associated with the centrosomes, the spindle and at the mid-body(PMID:20383198). It is required for EGF activated phosphorylation of histone H3, which may cause chromatin remodeling and facilitate gene transcription and maybe playing an essential regulatory role in protein synthesis during cell proliferation.

Protocols

Product Specific Protocols
IF protocol for RSK2 antibody 23762-1-APDownload protocol
IHC protocol for RSK2 antibody 23762-1-APDownload protocol
IP protocol for RSK2 antibody 23762-1-APDownload protocol
WB protocol for RSK2 antibody 23762-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB,IHC,CoIP

Cancer Lett

RSK2-mediated phosphorylation and degradation of UBE2O inhibits hepatocellular carcinoma growth and resistance to radiotherapy

Authors - Yumei Huang
  • KD Validated

Theranostics

S6K1 phosphorylation-dependent degradation of Mxi1 by β-Trcp ubiquitin ligase promotes Myc activation and radioresistance in lung cancer.

Authors - Yumei Huang
humanWB

Cell Death Differ

β-Trcp ubiquitin ligase and RSK2 kinase-mediated degradation of FOXN2 promotes tumorigenesis and radioresistance in lung cancer.

Authors - Jia Ma
humanWB

Oncogene

β-Trcp and CK1δ-mediated degradation of LZTS2 activates PI3K/AKT signaling to drive tumorigenesis and metastasis in hepatocellular carcinoma.

Authors - Yanwei Lu
humanWB

Int J Biochem Cell Biol

DHPAC, a novel synthetic microtubule destabilizing agent, possess high anti-tumor activity in vincristine-resistant oral epidermoid carcinoma in vitro and in vivo.

Authors - Ying Zhang
humanWB

Prostate

MicroRNA181c inhibits prostate cancer cell growth and invasion by targeting multiple ERK signaling pathway components.

Authors - Zhengzheng Su

Reviews

    5.0 out of 5
Add a review

7 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Iram (Verified Customer) (03-23-2026)

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Colon cancer

Sai Sindhura (Verified Customer) (03-23-2026)

Sharp bands with this antibody

  • Applications: Western Blot, Immunoprecipitation
  • Primary Antibody Dilution: 1:2000

Sai Sindhura (Verified Customer) (01-08-2026)

RSK 2 antibody is showing very good bands

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000

Iram (Verified Customer) (12-19-2025)

Very clear band.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000 for IB
  • Cell Tissue Type: CRC cells

Iram (Verified Customer) (09-18-2025)

Very good antibody

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: CRC cells

Morgane (Verified Customer) (09-15-2025)

Very clean band at expected size and a couple aspecific higher ones

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: HCT116
RSK2 Antibody Western Blot validation (1/1000 dilution) in HCT116 (Cat no:23762-1-AP)

Iram (Verified Customer) (09-04-2020)

Very clean bands of RSK2 in immunoblotting

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000 for western
  • Cell Tissue Type: Human colon cancer cells
Loading...
||
New chat

Able™

正在加载,请稍候...