RSL1D1 Polyclonal antibody

• 

  WB analysis using 27667-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27667-1-AP (RSL1D1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27667-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27667-1-AP (RSL1D1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27667-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27667-1-AP (RSL1D1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse colon using 27667-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 27667-1-AP (RSL1D1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse colon using 27667-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 27667-1-AP (RSL1D1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

RSL1D1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27667-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse and More (1)

Applications

WB, IHC, ELISA

Synonyms

CATX 11, CATX11, CSIG, L12, PBK1, Protein PBK1, RSL1D1

---

Tested Applications

• Positive WB detected in: U-251 cells, HCT 116 cells, HEK-293 cells, SW480 cells, K-562 cells, HepG2 cells, PC-3 cells
• Positive IHC detected in: mouse colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

27667-1-AP targets RSL1D1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24923

  Product name: Recombinant human RSL1D1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 269-490 aa of BC112228

  Sequence: SNWDEATKRSLLNKKKKEARRKRRERNFEKQKERKKKRQQARKTASVLSKDDVAPESGDTTVKKPESKKEQTPEHGKKKRGRGKAQVKATNESEDEIPQLVPIGKKTPANEKVEIQKHATGKKSPAKSPNPSTPRGKKRKALPASETPKAAESETPGKSPEKKPKIKEEAVKEKSPSLGKKDARQTPKKPEAKFFTTPSKSVRKASHTPKKWPKKPKVPQST

• Full Name: ribosomal L1 domain containing 1
• Calculated Molecular Weight: 490 aa, 55 kDa
• Observed Molecular Weight: 55-70 kDa
• GenBank Accession Number: BC112228
• Gene Symbol: RSL1D1
• Gene ID (NCBI): 26156
• RRID: AB_3085982
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O76021
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RL1D1, Ribosomal L1 domain-containing protein 1, also named CSIG, a member of the universal ribosomal protein uL1 family. RL1D1 regulates cellular senescence through inhibition of PTEN translation. It acts as a pro-apoptotic regulator in response to DNA damage (PMID: 18678645, PMID: 22419112). RSL1D1 promoted the progression of colorectal cancer through RAN-mediated autophagy suppression. RSL1D1 can be detected 70 kDa (PMID:35013134).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Gene; RSL1D1 regulates lung adenocarcinoma progression by inhibiting NRF2 ubiquitination; Authors - Qingzhu Yang ; KD Validated