RXRB Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP01484-2

  Sandwich ELISA standard curve of MP01484-2, Human RXRB Recombinant Matched Antibody Pair - PBS only. 84656-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag0263. 84656-1-PBS was HRP conjugated as the detection antibody. Range: 1.56-100 ng/mL.

• 

  Sample test of MP01484-2

  The mean RXRB concentration was determined to be 256.21 ng/mL in MCF-7 cell extract based on a 1.20 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP01484-2

  Cytometric bead array standard curve of MP01484-2, RXRB Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 84656-2-PBS. Detection antibody: 84656-1-PBS. Standard: Ag0263. Range: 0.313-40 ng/mL.

RXRB Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 84656-2-PBS

Clone No.242178D6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

DAUDI6, H 2RIIBP, NR2B2, RCoR 1, Retinoic acid receptor RXR-beta

---

Product Information

84656-2-PBS targets RXRB as part of a matched antibody pair:

MP01484-2: 84656-2-PBS capture and 84656-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0263

  Product name: Recombinant human RXRB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 70-238 aa of BC001167

  Sequence: RDGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLT

• Full Name: retinoid X receptor, beta
• Calculated Molecular Weight: 57 kDa
• GenBank Accession Number: BC001167
• Gene Symbol: RXRB
• Gene ID (NCBI): 6257
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P28702
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.