Recoverin Monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recoverin Monoclonal antibody (66521-1-Ig)

Recoverin Monoclonal Antibody for WB, ELISA

Cat No. 66521-1-Ig Copied!

Clone No. 3B8E8

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

Human, rat, pig, mouse and More (1)

Applications

WB, ELISA

Synonyms

Protein CAR, RCV1, RCVRN, recoverin

• 

  WB analysis of pig retina using 66521-1-Ig

  pig retina tissue were subjected to SDS PAGE followed by western blot with 66521-1-Ig (Recoverin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat retina using 66521-1-Ig

  rat retina tissue were subjected to SDS PAGE followed by western blot with 66521-1-Ig (Recoverin antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Recoverin in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: pig retina tissue, rat retina tissue

Recommended dilution

• Western Blot (WB): WB : 1:2500-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66521-1-Ig targets Recoverin in WB, ELISA applications and shows reactivity with Human, rat, pig, mouse samples.

• Tested Reactivity: Human, rat, pig, mouse
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0119

  Product name: Recombinant human Recoverin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 7-166 aa of BC001720

  Sequence: GALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDK

• Full Name: recoverin
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC001720
• Gene Symbol: Recoverin
• Gene ID (NCBI): 5957
• RRID: AB_2881884
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P35243
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Recoverin, belonging to a family of the neuronal calcium sensor (NCS) proteins, has a restricted expression in retinal photoreceptors or neurons or neuroendocrine cells. It has been suggested to play a role in light and dark adaptation by regulating rhodopsin phosphorylation. Recently, it has been found that autoantibodies against recoverin (24 kDa) have been strongly associated with cancer -associated retinopathy (CAR) syndrome, a paraneoplastic disease of the retina. But functions of recoverin in cancer cells remain unknown.

Publications

What published studies show

The Recoverin Monoclonal antibody (3B8E8), catalog number 66521-1-Ig, has 1 total citation. It appears in Scientific Reports (2022), where it was used by Western blot to study oxidative stress effects on apical and basolateral secretion of angiogenic factors from human iPSC-derived retinal pigment epithelium cells. The research field encompasses retinal biology, oxidative stress, and angiogenesis.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Rep; Oxidative stress differentially impacts apical and basolateral secretion of angiogenic factors from human iPSC-derived retinal pigment epithelium cells.; Authors - Lisheng Chen