Recoverin Monoclonal antibody

• 

  WB analysis of pig retina using 66521-1-Ig

  pig retina tissue were subjected to SDS PAGE followed by western blot with 66521-1-Ig (Recoverin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat retina using 66521-1-Ig

  rat retina tissue were subjected to SDS PAGE followed by western blot with 66521-1-Ig (Recoverin antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

Recoverin Monoclonal Antibody for WB, ELISA

Cat No. 66521-1-Ig

Clone No.3B8E8

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

Human, rat, pig, mouse and More (1)

Applications

WB, ELISA

Synonyms

Protein CAR, RCV1, RCVRN, recoverin

---

Tested Applications

• Positive WB detected in: pig retina tissue, rat retina tissue

Recommended dilution

• Western Blot (WB): WB : 1:2500-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

66521-1-Ig targets Recoverin in WB, ELISA applications and shows reactivity with Human, rat, pig, mouse samples.

• Tested Reactivity: Human, rat, pig, mouse
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0119

  Product name: Recombinant human Recoverin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 7-166 aa of BC001720

  Sequence: GALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDK

• Full Name: recoverin
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC001720
• Gene Symbol: Recoverin
• Gene ID (NCBI): 5957
• RRID: AB_2881884
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P35243
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Recoverin, belonging to a family of the neuronal calcium sensor (NCS) proteins, has a restricted expression in retinal photoreceptors or neurons or neuroendocrine cells. It has been suggested to play a role in light and dark adaptation by regulating rhodopsin phosphorylation. Recently, it has been found that autoantibodies against recoverin (24 kDa) have been strongly associated with cancer -associated retinopathy (CAR) syndrome, a paraneoplastic disease of the retina. But functions of recoverin in cancer cells remain unknown.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Rep; Oxidative stress differentially impacts apical and basolateral secretion of angiogenic factors from human iPSC-derived retinal pigment epithelium cells.; Authors - Lisheng Chen