Recoverin Monoclonal antibody, PBS Only

• 

  WB analysis of pig retina using 66521-1-Ig (same clone as 66521-1-PBS)

  pig retina tissue were subjected to SDS PAGE followed by western blot with 66521-1-Ig (Recoverin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66521-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat retina using 66521-1-Ig (same clone as 66521-1-PBS)

  rat retina tissue were subjected to SDS PAGE followed by western blot with 66521-1-Ig (Recoverin antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66521-1-PBS in a different storage buffer formulation.

Recoverin Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66521-1-PBS

Clone No.3B8E8

Host / Isotype

Mouse / IgG1

Reactivity

Human, rat, pig, mouse

Applications

WB, Indirect ELISA

Synonyms

Protein CAR, RCV1, RCVRN, recoverin

---

Product Information

66521-1-PBS targets Recoverin in WB, Indirect ELISA applications and shows reactivity with Human, rat, pig, mouse samples.

• Tested Reactivity: Human, rat, pig, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0119

  Product name: Recombinant human Recoverin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 7-166 aa of BC001720

  Sequence: GALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDK

• Full Name: recoverin
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC001720
• Gene Symbol: Recoverin
• Gene ID (NCBI): 5957
• RRID: AB_2881884
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P35243
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Recoverin, belonging to a family of the neuronal calcium sensor (NCS) proteins, has a restricted expression in retinal photoreceptors or neurons or neuroendocrine cells. It has been suggested to play a role in light and dark adaptation by regulating rhodopsin phosphorylation. Recently, it has been found that autoantibodies against recoverin (24 kDa) have been strongly associated with cancer -associated retinopathy (CAR) syndrome, a paraneoplastic disease of the retina. But functions of recoverin in cancer cells remain unknown.