NF-κB p65 Polyclonal antibody

• 

  WB analysis using 33259-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33259-1-AP (NF-κB p65 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 33259-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33259-1-AP (Rela antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse lung using 33259-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 33259-1-AP (Rela antibody) at dilution of 1:3000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 33259-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 33259-1-AP (Rela antibody) at dilution of 1:3000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse lung using 33259-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using Rela antibody (33259-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse testis using 33259-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using Rela antibody (33259-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NF-κB p65 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 33259-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

NF Kappa B, NF κB, NF-kB, NFKB 3, NFKB p65

---

Tested Applications

• Positive WB detected in: A431 cells, NIH/3T3 cells, mouse testis tissue, rat testis tissue
• Positive IHC detected in: mouse testis tissue, mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse testis tissue, mouse lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1500-1:6000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33259-1-AP targets NF-κB p65 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40017

  Product name: Recombinant mouse Rela protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 425-549 aa of BC094053

  Sequence: KSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVDNSEFQQLLNQGVSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGTSGLPNGLSGDEDFSSIADMDFSALLSQISS*

• Full Name: v-rel reticuloendotheliosis viral oncogene homolog A (avian)
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC094053
• Gene Symbol: Rela
• Gene ID (NCBI): 19697
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q04207
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Rela, also known as p65, is one of the most critical and extensively studied members of the nuclear factor κB (NF-κB) transcription factor family. As the core executor of the NF-κB signaling pathway, it typically forms the canonical p65-p50 heterodimer with the p50 subunit. In the resting state, Rela is anchored in the cytoplasm by the IκB inhibitory protein. Once the cell receives external stimuli such as inflammatory cytokines (TNF-α, IL-1), pathogen-associated molecular patterns (PAMPs), or stress signals, the IκB kinase (IKK) complex is activated, leading to the degradation of IκB and the release of Rela/p65. The activated Rela rapidly translocates to the nucleus, initiating the transcription of a large number of target genes that are widely involved in key biological processes such as acute inflammatory responses, cell survival, proliferation, and differentiation. Therefore, Rela serves as the core hub connecting upstream signals with downstream gene expression and plays a crucial role in immune responses, inflammatory diseases, and cancer.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		J Ethnopharmacol; Buzhong Yiqi Decoction Improves Inflammation and Oxidative Damage in Autoimmune Thyroiditis by Inhibiting Apoptosis via the SIRT1-Mediated Nrf2/NF-κB Axis; Authors - Zhuo Zhao