Tested Applications
Positive WB detected in | mouse adipose tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
32786-1-AP targets Resistin in WB, ELISA applications and shows reactivity with mouse samples.
Tested Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Eg3391 Product name: Recombinant Mouse Resistin protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 21-114 aa of NM_001204959.1 Sequence: SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS Predict reactive species |
Full Name | resistin |
Calculated Molecular Weight | 12 kDa |
Observed Molecular Weight | 12 kDa |
GenBank Accession Number | NM_001204959.1 |
Gene Symbol | Retn |
Gene ID (NCBI) | 57264 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity Purification |
UNIPROT ID | Q99P87 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Resistin, an adipokine produced in fat tissue, is a cysteine rich protein with a molecular weight of 12 kDa. Resistin inhibits insulin action, signaling, and glucose metabolism. Previous data have suggested that resistin secretion is linked to insulin resistance (IR) and type 2 diabetes. Resistin expression in rodents is limited only to adipocytes, but human resistin is produced mainly by macrophages and monocytes, which show only 59% amino acid homology to mice. (PMID: 34325643, PMID: 32991315)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Resistin antibody 32786-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |