Resistin Polyclonal antibody

• 

  WB analysis using 32786-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32786-1-AP (Resistin antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. Mouse lung tissue as the negative control.

Resistin Polyclonal Antibody for WB, ELISA

Cat No. 32786-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, ELISA

Synonyms

Adipose tissue-specific secretory factor, Adipose-specific cysteine-rich secreted protein A12-alpha, ADSF, Cysteine-rich secreted protein FIZZ3, Fizz3

---

Tested Applications

• Positive WB detected in: mouse adipose tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32786-1-AP targets Resistin in WB, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg3391

  Product name: Recombinant Mouse Resistin protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 21-114 aa of NM_001204959.1

  Sequence: SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS

• Full Name: resistin
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: NM_001204959.1
• Gene Symbol: Retn
• Gene ID (NCBI): 57264
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q99P87
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Resistin, an adipokine produced in fat tissue, is a cysteine rich protein with a molecular weight of 12 kDa. Resistin inhibits insulin action, signaling, and glucose metabolism. Previous data have suggested that resistin secretion is linked to insulin resistance (IR) and type 2 diabetes. Resistin expression in rodents is limited only to adipocytes, but human resistin is produced mainly by macrophages and monocytes, which show only 59% amino acid homology to mice. (PMID: 34325643, PMID: 32991315)