Tested Applications
Positive WB detected in | MCF-7 cells, MDA-MB-468 cells |
Positive IHC detected in | human oesophagus cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
26656-1-AP targets S100A7/Psoriasin in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24717 Product name: Recombinant human S100A7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-35 aa of BC034687 Sequence: MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTM Predict reactive species |
Full Name | S100 calcium binding protein A7 |
Calculated Molecular Weight | 101 aa, 11 kDa |
Observed Molecular Weight | 11 kDa |
GenBank Accession Number | BC034687 |
Gene Symbol | S100A7/Psoriasin |
Gene ID (NCBI) | 6278 |
RRID | AB_2880592 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P31151 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
S100A7 (psoriasin), a member of the S100 protein family, is a well-known antimicrobial peptide and a signaling molecule which regulates cellular function and is expressed in many squamous cell carcinomas (SCCs), such as SCC of the skin. It is an EF-hand type calcium binding protein localized in epithelial cells, regulates cell proliferation and differentiation. The protein is overexpressed in hyperproliferative skin diseases, exhibits antimicrobial activities against bacteria and induces immunomodulatory activities.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for S100A7/Psoriasin antibody 26656-1-AP | Download protocol |
IHC protocol for S100A7/Psoriasin antibody 26656-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |