S100A8 Recombinant monoclonal antibody, PBS Only

• 

S100A8 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 82531-4-PBS

Clone No.242970A6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

CAGA, Calgranulin A, Calgranulin-A, Calprotectin L1L subunit, CFAG

---

Product Information

82531-4-PBS targets S100A8 in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3752

  Product name: Recombinant Human S100A8 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 1-93 aa of BC005928

  Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

• Full Name: S100 calcium binding protein A8
• Calculated Molecular Weight: 93 aa, 11 kDa
• GenBank Accession Number: BC005928
• Gene Symbol: S100A8
• Gene ID (NCBI): 6279
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P05109
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.