Product Information
83578-5-PBS targets S100A9 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag25764 Product name: Recombinant human S100A9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-114 aa of BC047681 Sequence: KLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP Predict reactive species |
Full Name | S100 calcium binding protein A9 |
Calculated Molecular Weight | 13 kDa |
GenBank Accession Number | BC047681 |
Gene Symbol | S100A9 |
Gene ID (NCBI) | 6280 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P06702 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |