S100A9 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 83578-5-PBS

  Biolayer interferometry (BLl) kinetic assay of 83578-5-PBS against Human S100A9 was performed. The affinity constant is 0.778 nM.

S100A9 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83578-5-PBS

Clone No.240539B1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

CAGB, Calgranulin B, Calgranulin-B, Calprotectin L1H subunit, CFAG

---

Product Information

83578-5-PBS targets S100A9 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25764

  Product name: Recombinant human S100A9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-114 aa of BC047681

  Sequence: KLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

• Full Name: S100 calcium binding protein A9
• Calculated Molecular Weight: 13 kDa
• GenBank Accession Number: BC047681
• Gene Symbol: S100A9
• Gene ID (NCBI): 6280
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P06702
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.