SACM1L Polyclonal antibody

• 

  WB analysis of human kidney using 13033-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 13033-1-AP (SACM1L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 13033-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13033-1-AP (SACM1L antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 13033-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 13033-1-AP (SACM1L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 13033-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 13033-1-AP (SACM1L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 13033-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 13033-1-AP (SACM1L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse kidney using 13033-1-AP

  IP result of anti-SACM1L (IP:13033-1-AP, 4ug; Detection:13033-1-AP 1:1000) with mouse kidney tissue lysate 4000ug.

• 

  IHC staining of human brain using 13033-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 13033-1-AP (SACM1L antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human brain using 13033-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 13033-1-AP (SACM1L antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human heart using 13033-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 13033-1-AP (SACM1L Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human heart using 13033-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 13033-1-AP (SACM1L Antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of A549 using 13033-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed A549 cells using 13033-1-AP (SACM1L antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

SACM1L Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13033-1-AP

Publications(18)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Suppressor of actin mutations 1-like protein, SAC1, Phosphatidylinositol-4-phosphate phosphatase, Phosphatidylinositol-3-phosphatase SAC1, KIAA0851

---

Tested Applications

• Positive WB detected in: human kidney tissue, A549 cells, mouse kidney tissue, mouse lung tissue, human brain tissue
• Positive IP detected in: mouse kidney tissue
• Positive IHC detected in: human brain tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 6 publications below
• WB: See 15 publications below
• IF: See 6 publications below
• IP: See 1 publications below

Product Information

13033-1-AP targets SACM1L in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3682

  Product name: Recombinant human SACM1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 154-500 aa of BC016559

  Sequence: QEMSLLERADQRFVWNGHLLRELSAQPEVHRFALPVLHGFITMHSCSINGKYFDWILISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIVHYNGSKASFVQTRGSIPVFWSQRPNLKYKPLPQISKVANHMDGFQRHFDSQVIIYGKQVIINLINQKGSEKPLEQTFATMVSSLGSGMMRYIAFDFHKECKNMRWDRLSILLDQVAEMQDELSYFLVDSAGQVVANQEGVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHVGQKLEEQDEFEKIFKNAWADNANACAKQYAGTGALKTDFTRTGKRTHLGLIMDGWNSMIRYYKNNFSDGFRQDSIDLFLG

• Full Name: SAC1 suppressor of actin mutations 1-like (yeast)
• Calculated Molecular Weight: 587 aa, 67 kDa
• Observed Molecular Weight: 60-67 kDa
• GenBank Accession Number: BC016559
• Gene Symbol: SACM1L
• Gene ID (NCBI): 22908
• RRID: AB_2301284
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NTJ5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SACM1L(Suppressor of actin mutations 1-like protein) is also named KIAA0851. It is a phosphoinositide phosphatase that hydrolyzes PtdIns3P and PtdIns4P and has low activity towards PtdIns(3,5)P2.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	Cell Res; Intercellular transfer of activated STING triggered by RAB22A-mediated non-canonical autophagy promotes antitumor immunity; Authors - Ying Gao
	IP	Cell Host Microbe; Global mapping of Salmonella enterica-host protein-protein interactions during infection.; Authors - Philipp Walch
mouse	WB	Neuron; An ER Assembly Line of AMPA-Receptors Controls Excitatory Neurotransmission and Its Plasticity.; Authors - Jochen Schwenk
human	WB	Autophagy; PtdIns4P restriction by hydrolase SAC1 decides specific fusion of autophagosomes with lysosomes.; Authors - Hongjun Zhang ; KD Validated
human	WB	Proc Natl Acad Sci U S A; Addiction to Golgi-resident PI4P synthesis in chromosome 1q21.3-amplified lung adenocarcinoma cells.; Authors - Lei Shi
human	WB,IF	J Cell Biol; Sensing of nutrients by CPT1C controls SAC1 activity to regulate AMPA receptor trafficking.; Authors - Maria Casas