SASH1 Polyclonal antibody

• 

  WB analysis using 27689-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27689-1-AP (SASH1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of U2OS using 27689-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using SASH1 antibody (27689-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4), CL488-Phalloidin (green).

SASH1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 27689-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

KIAA0790, PEPE1, Proline-glutamate repeat-containing protein, RP3 323M4.1, SAM and SH3 domain-containing protein 1

---

Tested Applications

• Positive WB detected in: SKOV-3 cells, U-251 cells, U-87 MG cells
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27689-1-AP targets SASH1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26771

  Product name: Recombinant human SASH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 76-191 aa of NM_015278

  Sequence: MDVCERMEELRKRRVSQDLEVEKPDASPTSLQLRSQIEESLGFCSAVSTPEVERKNPLHKSNSEDSSVGKGDWKKKNKYFWQNFRKNQKGIMRQTSKGEDVGYVASEITMSDEERIQ

• Full Name: SAM and SH3 domain containing 1
• Calculated Molecular Weight: 137 kDa
• Observed Molecular Weight: 170 kDa
• GenBank Accession Number: NM_015278
• Gene Symbol: SASH1
• Gene ID (NCBI): 23328
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94885
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SAM and SH3 domain-containing protein 1 (SASH1, also known as KIAA0790 and PEPE1) is a multidomain protein implicated in various cellular processes, including cell adhesion, migration, and apoptosis. It has been identified as a novel Eph receptor-binding partner through SAM-SAM domain interactions, which are critical for the recruitment and binding of downstream molecules in the Eph signaling pathway (PMID: 37619706). SASH1 is also known to regulate signaling through focal adhesion kinase (FAK) and AKT/PI3K and promote apoptosis. Mutations in SASH1 have been associated with cancers, and it is suggested as a potential therapeutic target in non-small cell lung cancer (PMID: 33122723).