SLC26A1 Polyclonal antibody

• 

  WB analysis of mouse spleen using 26611-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 26611-1-AP (SAT1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 26611-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 26611-1-AP (SAT1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse kidney using 26611-1-AP

  IP result of anti-SAT1 (IP:26611-1-AP, 4ug; Detection:26611-1-AP 1:1000) with mouse kidney tissue lysate 5400ug.

SLC26A1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 26611-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IF, IP, ELISA

Synonyms

EDM4, SAT 1, SAT1, SLC26A1, Sulfate anion transporter 1

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse spleen tissue
• Positive IP detected in: mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

26611-1-AP targets SLC26A1 in WB, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24306

  Product name: Recombinant human SLC26A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-70 aa of BC015517

  Sequence: MDESPEPLQQGRGPVPVRRQRPAPRGLREMLKARLWCSCSCSVLCVRALVQDLLPATRWLRQYRPREYLA

• Full Name: solute carrier family 26 (sulfate transporter), member 1
• Calculated Molecular Weight: 75 kDa
• Observed Molecular Weight: 70 kDa~85 kDa
• GenBank Accession Number: BC015517
• Gene Symbol: SLC26A1
• Gene ID (NCBI): 10861
• RRID: AB_2880574
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H2B4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Chem Res Toxicol; The Potential Contribution of Hexavalent Chromium to the Carcinogenicity of Chrysotile Asbestos; Authors - Martin Walter
rat	IF	Gut Microbes; Gut microbiota modulation via fecal microbiota transplantation mitigates hyperoxaluria and calcium oxalate crystal depositions induced by high oxalate diet; Authors - Lingyue An