SBK2 Polyclonal antibody

• 

  WB analysis using 32117-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32117-1-AP (SBK2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A549 using 32117-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using SBK2 antibody (32117-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

SBK2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 32117-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Sugen kinase 69 (SgK069), SH3 domain-binding kinase family member 2, SGK069, Serine/threonine-protein kinase SBK2

---

Tested Applications

• Positive WB detected in: A549 cells, HepG2 cells, Kasumi-1 cells
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32117-1-AP targets SBK2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37233

  Product name: Recombinant human SBK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 185-348 aa of NM_001101401

  Sequence: KPENVLVCDPACRRFKLTDFGHTRPRGTLLRLAGPPIPYTAPELCAPPPLPEGLPIQPALDAWALGVLLFCLLTGYFPWDRPLAEADPFYEDFLIWQASGQPRDRPQPWFGLAAAADALLRGLLDPHPRRRSAVIAIREHLGRPWRQREGEAEAVGAVEEEAGQ

• Full Name: SH3-binding domain kinase family, member 2
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: NM_001101401
• Gene Symbol: SBK2
• Gene ID (NCBI): 646643
• RRID: AB_3670197
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P0C263
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SH3 domain binding kinase family member 2 (SBK2, also known as SGK069), is an evolutionarily conserved putative serine/threonine protein kinase that plays a crucial role in cardiomyocyte differentiation, particularly in the formation and maintenance of sarcomeres. It is highly atrium-enriched and is muscle-specific, indicating its specialized function in cardiac muscle cells (PMID: 35587025). SBK2 may be useful for identifying and co-registering tumor borders during surgical resection (PMID: 23730413).