SCARF1 Polyclonal antibody, PBS Only

• 

  WB analysis using 28174-1-AP (same clone as 28174-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28174-1-AP (SCARF1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28174-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 28174-1-AP (same clone as 28174-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SCARF1 antibody (28174-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 28174-1-PBS in a different storage buffer formulation.

SCARF1 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 28174-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Acetyl LDL receptor, KIAA0149, Scavenger receptor class F member 1, Scavenger receptor expressed by endothelial cells 1, SREC

---

Product Information

28174-1-PBS targets SCARF1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28079

  Product name: Recombinant human SCARF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 695-830 aa of BC039735

  Sequence: AGKPRGSEGPVRSVFRHFGSFQKGQAEAKVKRAIPKPPRQALNRKKGSPGLASGSVGQSPNSAPKAGLPGATGPMAVRPEEAVRGLGAGTESSRRAQEPVSGCGSPEQDPQKQAEEERQEEPEYENVVPISRPPEP

• Full Name: scavenger receptor class F, member 1
• Calculated Molecular Weight: 830 aa, 87 kDa
• Observed Molecular Weight: 90 kDa, 180 kDa
• GenBank Accession Number: BC039735
• Gene Symbol: SCARF1
• Gene ID (NCBI): 8578
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14162
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Scavenger receptor class F member 1 (SCARF1), also known as scavenger receptor expressed by endothelial cells (SREC)-I, belongs to the scavenger receptor (SR) superfamily. SCARF1 has been shown to bind modified low density lipoproteins (LDLs), including acetylated (Ac-) and oxidized (ox-) LDLs (PMID: 29725698; PMID: 15145948). In addition to binding and internalizing a diverse range of endogenous proteins, SCARF1 also binds a wide array of viral, fungal, and bacterial antigens (PMID: 29242513). SCARF1 has a calculated molecular weight of 87 kDa, with a molecular weight of 140-160 kDa due to N-glycosylation (PMID: 22279061; PMID: 15145948). SCARF1 can also exist as a dimer (~ 180 kDa) and a truncated soluble form (~ 60 kDa) (PMID: 29242513; PMID: 29725698).