SCARF1 Polyclonal antibody, PBS Only

SCARF1 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 28174-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Acetyl LDL receptor, KIAA0149, Scavenger receptor class F member 1, Scavenger receptor expressed by endothelial cells 1, SREC

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

28174-1-PBS targets SCARF1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag28079

Product name: Recombinant human SCARF1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 695-830 aa of BC039735

Sequence: AGKPRGSEGPVRSVFRHFGSFQKGQAEAKVKRAIPKPPRQALNRKKGSPGLASGSVGQSPNSAPKAGLPGATGPMAVRPEEAVRGLGAGTESSRRAQEPVSGCGSPEQDPQKQAEEERQEEPEYENVVPISRPPEP

Predict reactive species
Full Name scavenger receptor class F, member 1
Calculated Molecular Weight 830 aa, 87 kDa
Observed Molecular Weight90 kDa, 180 kDa
GenBank Accession NumberBC039735
Gene Symbol SCARF1
Gene ID (NCBI) 8578
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ14162
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Scavenger receptor class F member 1 (SCARF1), also known as scavenger receptor expressed by endothelial cells (SREC)-I, belongs to the scavenger receptor (SR) superfamily. SCARF1 has been shown to bind modified low density lipoproteins (LDLs), including acetylated (Ac-) and oxidized (ox-) LDLs (PMID: 29725698; PMID: 15145948). In addition to binding and internalizing a diverse range of endogenous proteins, SCARF1 also binds a wide array of viral, fungal, and bacterial antigens (PMID: 29242513). SCARF1 has a calculated molecular weight of 87 kDa, with a molecular weight of 140-160 kDa due to N-glycosylation (PMID: 22279061; PMID: 15145948). SCARF1 can also exist as a dimer (~ 180 kDa) and a truncated soluble form (~ 60 kDa) (PMID: 29242513; PMID: 29725698).

Loading...
||
New chat Able
正在加载,请稍候...