SCN3B Polyclonal antibody, PBS Only

SCN3B Polyclonal Antibody for WB, Indirect ELISA
Cat No. 25907-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

HSA243396, KIAA1158, SCNB3, Sodium channel regulatory subunit beta-3, Sodium channel subunit beta 3

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

25907-1-PBS targets SCN3B in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag23201

Product name: Recombinant human SCN3B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 23-93 aa of BC126265

Sequence: FPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQ

Predict reactive species
Full Name sodium channel, voltage-gated, type III, beta
Observed Molecular Weight 45-50 kDa
GenBank Accession NumberBC126265
Gene Symbol SCN3B
Gene ID (NCBI) 55800
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NY72
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The sodium channel is a multi-subunit protein complex composed of a single large α-subunit along with smaller additional β-subunits. There are at least three different β-subunit genes, SCN1b, SCN2b, and SCN3b, all of which are expressed widely in excitable tissues. The bands on Western blots for SCN3b (45-50 kDa) were significantly larger than the predicted molecular weight, which is consistent with the protein being glycosylated. The two bands on the Western blot could be due to different levels of glycosylation or alternative spliced isoforms. (PMID: 11744748)

Loading...
||
New chat Able
正在加载,请稍候...