Tested Applications
| Positive WB detected in | HEK-293 cells, HUVEC cells, HepG2 cells |
| Positive IHC detected in | mouse skeletal muscle tissue, human hepatocirrhosis tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse skeletal muscle tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 12 publications below |
| IHC | See 3 publications below |
Product Information
21223-1-AP targets SCO2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15663 Product name: Recombinant human SCO2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-266 aa of BC102025 Sequence: MLLLTRSPTAWHRLSQLKPRVLPGTLGGQALHLRSWLLSRQGPAETGGQGQPQGPGLRTRLLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS Predict reactive species |
| Full Name | SCO cytochrome oxidase deficient homolog 2 (yeast) |
| Calculated Molecular Weight | 266 aa, 30 kDa |
| Observed Molecular Weight | 27-30 kDa |
| GenBank Accession Number | BC102025 |
| Gene Symbol | SCO2 |
| Gene ID (NCBI) | 9997 |
| RRID | AB_10694574 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43819 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Human SCO2 is a mitochondrial membrane-bound protein involved in copper supply for the assembly of cytochrome c oxidase in eukaryotes.It is involved in the maintenance of cell copper homeostasis or, limited to HSco2, as a downstream mediator of the Warburg effect, as its expression is regulated by p53(PMID:17850752).This protein belongs to the SCO1/2 family and defects in SCO2 are the cause of fatal infantile cardioencephalomyopathy with cytochrome c oxidase deficiency (FIC).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SCO2 antibody 21223-1-AP | Download protocol |
| IHC protocol for SCO2 antibody 21223-1-AP | Download protocol |
| WB protocol for SCO2 antibody 21223-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab Cooperation between COA6 and SCO2 in COX2 maturation during cytochrome c oxidase assembly links two mitochondrial cardiomyopathies. | ||
Cell Death Differ Mitophagy protein PINK1 suppresses colon tumor growth by metabolic reprogramming via p53 activation and reducing acetyl-CoA production. | ||
EMBO Mol Med APOPT1/COA8 assists COX assembly and is oppositely regulated by UPS and ROS. | ||
Oncotarget The oncoprotein HBXIP promotes glucose metabolism reprogramming via downregulating SCO2 and PDHA1 in breast cancer. | ||
Int J Mol Sci SLMP53-1 Inhibits Tumor Cell Growth through Regulation of Glucose Metabolism and Angiogenesis in a P53-Dependent Manner. | ||
PLoS One Mitochondrial dysfunction in Pten haplo-insufficient mice with social deficits and repetitive behavior: interplay between Pten and p53. |















