SDS Polyclonal antibody, PBS Only

SDS Polyclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 16594-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

EC:4.3.1.17, EC:4.3.1.19, L serine deaminase, L threonine dehydratase, L-serine deaminase

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

16594-1-PBS targets SDS in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9704

Product name: Recombinant human SDS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-218 aa of BC020750

Sequence: MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITR

Predict reactive species
Full Name serine dehydratase
Calculated Molecular Weight 218 aa, 23 kDa
Observed Molecular Weight35 kDa; 70 kDa
GenBank Accession NumberBC020750
Gene Symbol SDS
Gene ID (NCBI) 10993
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP20132
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

L-Serine dehydratase (SDS ; SDH) catalyzes the pyridoxal phosphate (PLP) dependent deamination of l-serine to yield pyruvate. In mammals, SDH is found predominantly in the liver. Extensive studies have been carried out on SDH from rat and the enzyme has been found to play an important role in gluconeogenesis; its activity is induced by the consumption of high-protein diets, starvation and other treatments. The enzyme exists as a dimer of identical subunits, with each subunit exhibiting a bilobal architecture. (PMID: 25380533, PMID: 21878319, PMID: 14646100)

Loading...
||
New chat Able
正在加载,请稍候...