SEC5/EXOC2 Polyclonal antibody

• 

  WB analysis of mouse brain using 12751-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12751-1-AP (SEC5/EXOC2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human ileum using 12751-1-AP

  human ileum tissue were subjected to SDS PAGE followed by western blot with 12751-1-AP (SEC5/EXOC2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 12751-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12751-1-AP (SEC5/EXOC2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 12751-1-AP

  IP result of anti-SEC5/EXOC2 (IP:12751-1-AP, 5ug; Detection:12751-1-AP 1:500) with mouse brain tissue lysate 3000ug.

• 

  IHC staining of human breast cancer using 12751-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 12751-1-AP (SEC5/EXOC2 antibody) at dilution of 1:100 (under 10x lens).

• 

  IF Staining of HeLa using 12751-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 12751-1-AP (SEC5/EXOC2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

SEC5/EXOC2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 12751-1-AP

Publications(21)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

SEC5L1, SEC5, Exocyst complex component Sec5, Exocyst complex component 2, EXOC2

---

Tested Applications

• Positive WB detected in: mouse brain tissue, human brain tissue, human ileum tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 8 publications below
• WB: See 19 publications below
• IHC: See 1 publications below
• IF: See 7 publications below
• IP: See 1 publications below
• CoIP: See 2 publications below

Product Information

12751-1-AP targets SEC5/EXOC2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3147

  Product name: Recombinant human SEC5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 456-806 aa of BC016918

  Sequence: TIQDLILDLRVRCVMATLQHTAEEIKRLAEKEDWIVDNEGLTSLPCQFEQCIVCSLQSLKGVLECKPGEASVFQQPKTQEEVCQLSINIMQVFIYCLEQLSTKPDADIDTTHLSVDVSSPDLFGSIHEDFSLTSEQRLLIVLSNCCYLERHTFLNIAEHFEKHNFQGIEKITQVSMASLKELDQRLFENYIELKADPIVGSLEPGIYAGYFDWKDCLPPTGVRNYLKEALVNIIAVHAEVFTISKELVPRVLSKVIEAVSEELSRLMQCVSSFSKNGALQARLEICALRDTVAVYLTPESKSSFKQALEALPQLSSGADKKLLEELLNKFKSSMHLQLTCFQAASSTMMKT

• Full Name: exocyst complex component 2
• Calculated Molecular Weight: 924 aa, 104 kDa
• Observed Molecular Weight: 95-100 kDa
• GenBank Accession Number: BC016918
• Gene Symbol: SEC5
• Gene ID (NCBI): 55770
• RRID: AB_2262528
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96KP1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EXOC2 (exocyst complex component 2), also known as SEC5 and SEC5L1, is a component of the exocyst complex, and is required to mediate RalB-dependent survival signals in transformed cells. The exocyst complex, composed of eight evolutionarily conserved subunits (SEC3, SEC5, SEC6, SEC8, SEC10, SEC15, EXO70, and EXO84), is involved in tethering post-Golgi secretory vesicles to specific plasma membrane domains. The gene of EXOC2 maps to chromosome 6p25.3, and encodes a 924-amino acid protein with an experimentally determined molecular mass of 95-100 kDa. EXOC2 mRNA is widely expressed with highest levels in brain and placenta.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell; A kinase-independent role for EGF receptor in autophagy initiation.; Authors - Xiaojun Tan ; KD Validated
human	WB	Nat Cell Biol; M-Sec promotes membrane nanotube formation by interacting with Ral and the exocyst complex.; Authors - Hase Koji K ; KD Validated
human	WB,IF	Nat Cell Biol; The deubiquitylase USP33 discriminates between RALB functions in autophagy and innate immune response.; Authors - Simicek Michal M ; KD Validated
human	WB	Blood; vWF maturation and release are controlled by two regulators of Weibel-Palade body biogenesis: exocyst and BLOC-2.; Authors - Anish Vaibhav Sharda
mouse	WB,IP	Mol Cell; The anti-inflammatory TIPE2 is an inhibitor of the oncogenic Ras.; Authors - Gus-Brautbar Yael Y
mouse	WB,CoIP	Sci Signal; Phosphorylation of the exocyst protein Exo84 by TBK1 promotes insulin-stimulated GLUT4 trafficking.; Authors - Maeran Uhm