SEC5/EXOC2 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• SEC5/EXOC2 Monoclonal antibody (66011-1-Ig)

• Featured Product
• KD/KO Validated

SEC5/EXOC2 Monoclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 66011-1-Ig

Clone No.1C11G2

Publications(6)

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

1C11G2, EXOC2, Exocyst complex component 2, Exocyst complex component Sec5, SEC5

• 

  WB analysis of HEK-293 using 66011-1-Ig

  WB result of SEC5/EXOC2 antibody (66011-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SEC5/EXOC2 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 66011-1-Ig

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 66011-1-Ig (SEC5/EXOC2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig brain using 66011-1-Ig

  pig brain tissue were subjected to SDS PAGE followed by western blot with 66011-1-Ig (SEC5/EXOC2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig cerebellum using 66011-1-Ig

  pig cerebellum tissue were subjected to SDS PAGE followed by western blot with 66011-1-Ig (SEC5/EXOC2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat brain using 66011-1-Ig

  rat brain tissue were subjected to SDS PAGE followed by western blot with 66011-1-Ig (SEC5/EXOC2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat cerebellum using 66011-1-Ig

  rat cerebellum tissue were subjected to SDS PAGE followed by western blot with 66011-1-Ig (SEC5/EXOC2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 66011-1-Ig

  human brain tissue were subjected to SDS PAGE followed by western blot with 66011-1-Ig (SEC5/EXOC2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 66011-1-Ig

  IP result of anti-SEC5/EXOC2 (IP:66011-1-Ig, 5ug; Detection:66011-1-Ig 1:500) with mouse brain tissue lysate 3440ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 66011-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66011-1-Ig (SEC5/EXOC2 antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 66011-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66011-1-Ig (SEC5/EXOC2 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 66011-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66011-1-Ig (SEC5/EXOC2 antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 66011-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66011-1-Ig (SEC5/EXOC2 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 66011-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SEC5/EXOC2 antibody (66011-1-Ig, Clone: 1C11G2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 66011-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SEC5/EXOC2 antibody (66011-1-Ig, Clone: 1C11G2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MDA-MB-231 using 66011-1-Ig

  Immunostaining of exocyst protein Sec5 (66011-1-Ig, red) in MDA-MB-231 cells. The image was credited by Dr. Hae Lin Jang from Harvard Medical School.

---

Tested Applications

• Positive WB detected in: mouse brain tissue, pig brain tissue, human brain tissue, pig cerebellum tissue, rat brain tissue, rat cerebellum tissue, HEK-293 cells
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human breast cancer tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2500-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66011-1-Ig targets SEC5/EXOC2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17866

  Product name: Recombinant human SEC5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 456-806 aa of BC016918

  Sequence: TIQDLILDLRVRCVMATLQHTAEEIKRLAEKEDWIVDNEGLTSLPCQFEQCIVCSLQSLKGVLECKPGEASVFQQPKTQEEVCQLSINIMQVFIYCLEQLSTKPDADIDTTHLSVDVSSPDLFGSIHEDFSLTSEQRLLIVLSNCCYLERHTFLNIAEHFEKHNFQGIEKITQVSMASLKELDQRLFENYIELKADPIVGSLEPGIYAGYFDWKDCLPPTGVRNYLKEALVNIIAVHAEVFTISKELVPRVLSKVIEAVSEELSRLMQCVSSFSKNGALQARLEICALRDTVAVYLTPESKSSFKQALEALPQLSSGADKKLLEELLNKFKSSMHLQLTCFQAASSTMMKT

• Full Name: exocyst complex component 2
• Calculated Molecular Weight: 924 aa, 104 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC016918
• Gene Symbol: SEC5
• Gene ID (NCBI): 55770
• RRID: AB_11042317
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96KP1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EXOC2 (exocyst complex component 2), also known as SEC5 and SEC5L1, is a component of the exocyst complex, and is required to mediate RalB-dependent survival signals in transformed cells. The exocyst complex, composed of eight evolutionarily conserved subunits (SEC3, SEC5, SEC6, SEC8, SEC10, SEC15, EXO70, and EXO84), is involved in tethering post-Golgi secretory vesicles to specific plasma membrane domains. The gene of EXOC2 maps to chromosome 6p25.3, and encodes a 924-amino acid protein with an experimentally determined molecular mass of 95-100 kDa. EXOC2 mRNA is widely expressed with highest levels in brain and placenta.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Nat Nanotechnol; Intercellular nanotubes mediate mitochondrial trafficking between cancer and immune cells.; Authors - Tanmoy Saha ; KD Validated
human	IF	PLoS Pathog; Shigella hijacks the exocyst to cluster macropinosomes for efficient vacuolar escape.; Authors - Yuen-Yan Chang
human		J Cell Sci; Dexamethasone-induced cellular tension requires SGK1-stimulated Sec5/GEF-H1 interaction.; Authors - Hong-Ling Wang
human	IF	Int J Cancer; Myoferlin plays a key role in VEGFA secretion and impacts tumor-associated angiogenesis in human pancreas cancer.; Authors - Karim Fahmy
human	WB,IF	Placenta; Exocyst complex protein expression in the human placenta.; Authors - I M Gonzalez
mouse	WB	Commun Biol; The exocyst complex and intracellular vesicles mediate soluble protein trafficking to the primary cilium; Authors - S M Niedziółka