CoraLite® Plus 488-conjugated SEC5/EXOC2 Monoclonal antibody

• 

  IF Staining of HeLa using CL488-66011

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 SEC5/EXOC2 antibody (CL488-66011, Clone: 1C11G2 ) at dilution of 1:400, CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

SEC5/EXOC2 Monoclonal Antibody for IF/ICC

Cat No. CL488-66011

Clone No.1C11G2

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, pig, rat

Applications

IF/ICC

Synonyms

EXOC2, exocyst complex component 2, Exocyst complex component Sec5, FLJ11026, SEC5, SEC5/EXOC2, SEC5L1, Sec5p

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66011 targets SEC5/EXOC2 in IF/ICC applications and shows reactivity with human, mouse, pig, rat samples.

• Tested Reactivity: human, mouse, pig, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17866

  Product name: Recombinant human SEC5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 456-806 aa of BC016918

  Sequence: TIQDLILDLRVRCVMATLQHTAEEIKRLAEKEDWIVDNEGLTSLPCQFEQCIVCSLQSLKGVLECKPGEASVFQQPKTQEEVCQLSINIMQVFIYCLEQLSTKPDADIDTTHLSVDVSSPDLFGSIHEDFSLTSEQRLLIVLSNCCYLERHTFLNIAEHFEKHNFQGIEKITQVSMASLKELDQRLFENYIELKADPIVGSLEPGIYAGYFDWKDCLPPTGVRNYLKEALVNIIAVHAEVFTISKELVPRVLSKVIEAVSEELSRLMQCVSSFSKNGALQARLEICALRDTVAVYLTPESKSSFKQALEALPQLSSGADKKLLEELLNKFKSSMHLQLTCFQAASSTMMKT

• Full Name: exocyst complex component 2
• Calculated Molecular Weight: 924 aa, 104 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC016918
• Gene Symbol: SEC5
• Gene ID (NCBI): 55770
• RRID: AB_2883226
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96KP1
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

EXOC2 (exocyst complex component 2), also known as SEC5 and SEC5L1, is a component of the exocyst complex, and is required to mediate RalB-dependent survival signals in transformed cells. The exocyst complex, composed of eight evolutionarily conserved subunits (SEC3, SEC5, SEC6, SEC8, SEC10, SEC15, EXO70, and EXO84), is involved in tethering post-Golgi secretory vesicles to specific plasma membrane domains. The gene of EXOC2 maps to chromosome 6p25.3, and encodes a 924-amino acid protein with an experimentally determined molecular mass of 95-100 kDa. EXOC2 mRNA is widely expressed with highest levels in brain and placenta.