• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated SEC5/EXOC2 Monoclonal antibody

SEC5/EXOC2 Monoclonal Antibody for IF/ICC
Cat No. CL594-66011
Clone No.1C11G2

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, pig, rat

Applications

IF/ICC

EXOC2, exocyst complex component 2, Exocyst complex component Sec5, FLJ11026, SEC5, SEC5L1, Sec5p

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66011 targets SEC5/EXOC2 in IF/ICC applications and shows reactivity with human, mouse, pig, rat samples.

Tested Reactivity human, mouse, pig, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17866

Product name: Recombinant human SEC5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 456-806 aa of BC016918

Sequence: TIQDLILDLRVRCVMATLQHTAEEIKRLAEKEDWIVDNEGLTSLPCQFEQCIVCSLQSLKGVLECKPGEASVFQQPKTQEEVCQLSINIMQVFIYCLEQLSTKPDADIDTTHLSVDVSSPDLFGSIHEDFSLTSEQRLLIVLSNCCYLERHTFLNIAEHFEKHNFQGIEKITQVSMASLKELDQRLFENYIELKADPIVGSLEPGIYAGYFDWKDCLPPTGVRNYLKEALVNIIAVHAEVFTISKELVPRVLSKVIEAVSEELSRLMQCVSSFSKNGALQARLEICALRDTVAVYLTPESKSSFKQALEALPQLSSGADKKLLEELLNKFKSSMHLQLTCFQAASSTMMKT

Predict reactive species
Full Name exocyst complex component 2
Calculated Molecular Weight 924 aa, 104 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC016918
Gene Symbol SEC5
Gene ID (NCBI) 55770
RRIDAB_2883476
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96KP1
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

EXOC2 (exocyst complex component 2), also known as SEC5 and SEC5L1, is a component of the exocyst complex, and is required to mediate RalB-dependent survival signals in transformed cells. The exocyst complex, composed of eight evolutionarily conserved subunits (SEC3, SEC5, SEC6, SEC8, SEC10, SEC15, EXO70, and EXO84), is involved in tethering post-Golgi secretory vesicles to specific plasma membrane domains. The gene of EXOC2 maps to chromosome 6p25.3, and encodes a 924-amino acid protein with an experimentally determined molecular mass of 95-100 kDa. EXOC2 mRNA is widely expressed with highest levels in brain and placenta.

Protocols

Product Specific Protocols
IF protocol for CL594 SEC5/EXOC2 antibody CL594-66011Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...