SELENOO Polyclonal antibody

• 

  WB analysis using 32860-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32860-1-AP (RP3-402G11.5 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

SELENOO Polyclonal Antibody for WB, ELISA

Cat No. 32860-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

EC:2.7.7.108, Protein adenylyltransferase SelO, mitochondrial, Selenoprotein O, SelO

---

Tested Applications

• Positive WB detected in: A549 cells, HEK-293 cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32860-1-AP targets SELENOO in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35939

  Product name: Recombinant human RP3-402G11.5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 477-666 aa of BC110866

  Sequence: LARLMEQCASLEELRLAFRPQMDPRQLSMMLMLAQSNPQLFALMGTRAGIARELERVEQQSRLEQLSAAELQSRNQGHWADWLQAYRARLDKDLEGAGDAAAWQAEHVRVMHANNPKYVLRNYIAQNAIEAAERGDFSEVRRVLKLLETPYHCEAGAATDAEATEADGADGRQRSYSSKPPLWAAELCVT

• Full Name: selenoprotein O
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC110866
• Gene Symbol: RP3-402G11.5
• Gene ID (NCBI): 83642
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9BVL4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SELENOO (Selenoprotein O) is a selenocysteine-containing (Sec) selenoprotein belonging to the oxidoreductase family, which is mainly localized in the endoplasmic reticulum (ER) membranes with multiple transmembrane structural domains. SELENOO plays important roles in a variety of cellular processes, including redox homeostasis and lipid metabolism and DNA damage repair. It plays an important role in a variety of cellular processes, including redox homeostasis, lipid metabolism, and DNA damage repair. SELENOO is aberrantly expressed in a variety of diseases, including cancer and neurodegenerative diseases. For example, in melanoma and lung cancer, the upregulation of SELENOO expression is associated with tumor progression and metastasis, which has become a hot topic in current research.