SEMA3C Polyclonal antibody

• 

SEMA3C Polyclonal Antibody for ELISA

Cat No. 14133-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

Sema E, SEMA3C, SEMAE, Semaphorin 3C, Semaphorin E, SemE

---

Product Information

14133-1-AP targets SEMA3C in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5333

  Product name: Recombinant human SEMA3C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 34-380 aa of BC030690

  Sequence: DELRETKTSEYFSLSHHPLDYRILLMDEDQDRIYVGSKDHILSLNINNISQEALSVFWPASTIKVEECKMAGKDPTHGCGNFVRVIQTFNRTHLYVCGSGAFSPVCTYLNRGRRSEDQVFMIDSKCESGKGRCSFNPNVNTVSVMINEELFSGMYIDFMGTDAAIFRSLTKRNAVRTDQHNSKWLSEPMFVDAHVIPDGTDPNDAKVYFFFKEKLTDNNRSTKQIHSMIARICPNDTGGLRSLVNKWTTFLKARLVCSVTDEDGPETHFDELEDVFLLETDNPRTTLVYGIFTTSSSVFKGSAVCVYHLSDIQTVFNGPFAHKEGPNHQLISYQGRIPYPRPGTCPG

• Full Name: sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C
• Calculated Molecular Weight: 85 kDa
• GenBank Accession Number: BC030690
• Gene Symbol: SEMA3C
• Gene ID (NCBI): 10512
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99985
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.