SERP1 Polyclonal antibody

• 

  WB analysis of mouse brain using 17807-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17807-1-AP (SERP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 17807-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 17807-1-AP (SERP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse pancreas using 17807-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 17807-1-AP (SERP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 17807-1-AP

  IP result of anti-SERP1 (IP:17807-1-AP, 4ug; Detection:17807-1-AP 1:500) with mouse brain tissue lysate 3160 ug.

• 

  IHC staining of human endometrial cancer using 17807-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 17807-1-AP (SERP1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human endometrial cancer using 17807-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 17807-1-AP (SERP1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of HeLa using 17807-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SERP1 antibody (17807-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

SERP1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 17807-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

RAMP4, Ribosome-attached membrane protein 4, Stress-associated endoplasmic reticulum protein 1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, HeLa cells, mouse pancreas tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human endometrial cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

17807-1-AP targets SERP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12087

  Product name: Recombinant human SERP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-66 aa of BC108314

  Sequence: MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM

• Full Name: stress-associated endoplasmic reticulum protein 1
• Calculated Molecular Weight: 66 aa, 7 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC108314
• Gene Symbol: SERP1
• Gene ID (NCBI): 27230
• RRID: AB_10597394
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6X1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Stress-associated endoplasmic reticulum (ER) protein 1 (SERP1), also known as ribosome- associated membrane protein 4 (RAMP4), is a Sec61-associated polypeptide that is induced by ER stress [PMID:16705175]. SERP1 interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. It controls glycosylation of major histocompatibility complex class II-associated invariant chains by a translocational pausing mechanism, and its overexpression stabilizes newly synthesized membrane proteins under ER stress by associating with the Sec61 complex [PMID:10601334]. It is suggested SERP1 is involved in the biosynthesis/processing of secretory proteins

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Viruses; A Dengue Virus Type 2 (DENV-2) NS4B-Interacting Host Factor, SERP1, Reduces DENV-2 Production by Suppressing Viral RNA Replication.; Authors - Jia-Ni Tian
human	IHC	Am J Transl Res; ER stress-related mRNA-lncRNA co-expression gene signature predicts the prognosis and immune implications of esophageal cancer; Authors - Feng Li
human	WB	Cell Rep; Coronavirus subverts ER-phagy by hijacking FAM134B and ATL3 into p62 condensates to facilitate viral replication; Authors - Xuan Tan
human	IHC	Cancer Med; Predicting Outcomes in Esophageal Squamous Cell Carcinoma Using scRNA-Seq and Bulk RNA-Seq: A Model Development and Validation Study; Authors - Jiaqi Zhang
rat	WB,IF	Cell Biol Int; SERP1 Alleviates Cerebral Ischemia/Reperfusion Injury by Inhibiting ER Stress-Mediated Apoptosis; Authors - Le Yin