Tested Applications
| Positive WB detected in | mouse brain tissue, HeLa cells, mouse pancreas tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human endometrial cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17807-1-AP targets SERP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12087 Product name: Recombinant human SERP1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-66 aa of BC108314 Sequence: MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM Predict reactive species |
| Full Name | stress-associated endoplasmic reticulum protein 1 |
| Calculated Molecular Weight | 66 aa, 7 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC108314 |
| Gene Symbol | SERP1 |
| Gene ID (NCBI) | 27230 |
| RRID | AB_10597394 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y6X1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Stress-associated endoplasmic reticulum (ER) protein 1 (SERP1), also known as ribosome- associated membrane protein 4 (RAMP4), is a Sec61-associated polypeptide that is induced by ER stress [PMID:16705175]. SERP1 interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. It controls glycosylation of major histocompatibility complex class II-associated invariant chains by a translocational pausing mechanism, and its overexpression stabilizes newly synthesized membrane proteins under ER stress by associating with the Sec61 complex [PMID:10601334]. It is suggested SERP1 is involved in the biosynthesis/processing of secretory proteins
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SERP1 antibody 17807-1-AP | Download protocol |
| IHC protocol for SERP1 antibody 17807-1-AP | Download protocol |
| IP protocol for SERP1 antibody 17807-1-AP | Download protocol |
| WB protocol for SERP1 antibody 17807-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SERP1 Polyclonal antibody (Cat# 17807-1-AP) has 5 citations published in Cell Reports, Viruses, Cancer Medicine, Cell Biology International, and American Journal of Translational Research. The associated research spans viral replication (coronavirus and dengue virus), esophageal squamous cell carcinoma prognosis, and cerebral ischemia/reperfusion injury involving ER stress-mediated apoptosis. Applications include Western blot and immunohistochemistry in human and rat samples.
| Species | Application | Title |
|---|---|---|
Cell Rep Coronavirus subverts ER-phagy by hijacking FAM134B and ATL3 into p62 condensates to facilitate viral replication | ||
Viruses A Dengue Virus Type 2 (DENV-2) NS4B-Interacting Host Factor, SERP1, Reduces DENV-2 Production by Suppressing Viral RNA Replication. | ||
Cancer Med Predicting Outcomes in Esophageal Squamous Cell Carcinoma Using scRNA-Seq and Bulk RNA-Seq: A Model Development and Validation Study | ||
Cell Biol Int SERP1 Alleviates Cerebral Ischemia/Reperfusion Injury by Inhibiting ER Stress-Mediated Apoptosis | ||
Am J Transl Res ER stress-related mRNA-lncRNA co-expression gene signature predicts the prognosis and immune implications of esophageal cancer |
