Serpin A12/Vaspin Polyclonal antibody

• 

  WB analysis of HepG2 using 17451-1-AP

  WB result of Serpin A12/Vaspin antibody (17451-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-Serpin A12/Vaspin transfected HepG2 cells.

• 

  WB analysis of human adipose using 17451-1-AP

  human adipose tissue were subjected to SDS PAGE followed by western blot with 17451-1-AP (SERPINA12 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

Serpin A12/Vaspin Polyclonal Antibody for WB, ELISA

Cat No. 17451-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, ELISA

Synonyms

SERPINA12, SERPINA12/Vaspin, Vaspin, OL 64, OL-64

---

Tested Applications

• Positive WB detected in: human adipose tissue, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

17451-1-AP targets Serpin A12/Vaspin in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11574

  Product name: Recombinant human SERPINA12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-414 aa of BC040857

  Sequence: MNPTLGLAIFLAVLLTVKGLLKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAGTGAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK

• Full Name: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12
• Calculated Molecular Weight: 414 aa, 47 kDa
• Observed Molecular Weight: 47-50 kDa
• GenBank Accession Number: BC040857
• Gene Symbol: Vaspin
• Gene ID (NCBI): 145264
• RRID: AB_2878408
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IW75
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SERPINA12 is also named as Serpin A12 and Visceral adipose tissue-derived serine protease inhibitor (Vaspin). Vaspin is an adipokine belonging to the serpin family, thus also named SERPINA12, with targets in kallikrein 7 and 14 that participates in skin desquamation (PMID: 34359881). Vaspin is a compensatory molecule in obesity and insulin resistance (PMID: 18321232). Vaspin is a newly described adipokine with an insulin sensitizing effect and inhibitory impact on food intake (PMID: 16030142, PMID: 21465327).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat,mouse	WB	Biochem Biophys Res Commun; Vaspin alleviates myocardial ischaemia/reperfusion injury via activating autophagic flux and restoring lysosomal function.; Authors - Feihong Yang