Tested Applications
| Positive WB detected in | human skeletal muscle tissue, HEK-293 cells, mouse liver tissue, human testis tissue, HeLa cells, K-562 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below | 
| WB | See 23 publications below | 
| IHC | See 2 publications below | 
Product Information
21668-1-AP targets SESN1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag16462 Product name: Recombinant human SESN1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC112036 Sequence: MAEGENEVRWDGLCSRDSTTRETALENIRQTILRKTEYLRSVKETPHRPSDGLSNTESSDGLNKLLAHLLMLSKRCPFKDVREKSEFILKSIQELGIRIPRPLGQGPSRFIPEKEILQVGSEDAQMHALFADSFAALGRLD Predict reactive species | 
                                    
| Full Name | sestrin 1 | 
| Calculated Molecular Weight | 551 aa, 64 kDa | 
| Observed Molecular Weight | 66-68 kDa | 
| GenBank Accession Number | BC112036 | 
| Gene Symbol | SESN1 | 
| Gene ID (NCBI) | 27244 | 
| RRID | AB_10793724 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q9Y6P5 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
Sestrins, including sestrin-1 (PA26), sestrin-2 (Hi95), and sestrin-3, are 48 to 65 kDa cystein sulfinyl reductases and they modulate peroxide signaling and antioxidant defense. These proteins selectively reduce or repair hyperoxidized forms of typical 2-Cys peroxiredoxins within eukaryotes. Expression of these proteins is regulated by p53, a tumor suppressor protein. Sestrin 1 is implicated in the inhibition of cell growth. It is approximately a 66kDa protein in humans (551 amino acids).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SESN1 antibody 21668-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Science Zonated leucine sensing by Sestrin-mTORC1 in the liver controls the response to dietary leucine. | ||
Proc Natl Acad Sci U S A Rag-Ragulator is the central organizer of the physical architecture of the mTORC1 nutrient-sensing pathway | ||
Biochim Biophys Acta Mol Basis Dis Exercise ameliorates chronic inflammatory response induced by high-fat diet via Sestrin2 in an Nrf2-dependent manner | ||
Osteoarthritis Cartilage Suppression of Sestrins in aging and osteoarthritic cartilage: dysfunction of an important stress defense mechanism. | 







