SESN1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SESN1 Polyclonal antibody (21668-1-AP)

• Featured Product
• KD/KO Validated

SESN1 Polyclonal Antibody for WB, ELISA

Cat No. 21668-1-AP Copied!

Publications (27)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

EC:1.11.1.-, p53 regulated protein PA26, p53-regulated protein PA26, PA26, SEST1

• 

  WB analysis using 21668-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21668-1-AP (SESN1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 21668-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21668-1-AP (SESN1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 21668-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21668-1-AP (SESN1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human skeletal muscle using 21668-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 21668-1-AP (SESN1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 21668-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 21668-1-AP (SESN1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human testis using 21668-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 21668-1-AP (SESN1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SESN1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, human skeletal muscle tissue, human testis tissue, mouse liver tissue, HeLa cells, K-562 cells, NIH/3T3 cells, mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:5000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21668-1-AP targets SESN1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16462

  Product name: Recombinant human SESN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-141 aa of BC112036

  Sequence: MAEGENEVRWDGLCSRDSTTRETALENIRQTILRKTEYLRSVKETPHRPSDGLSNTESSDGLNKLLAHLLMLSKRCPFKDVREKSEFILKSIQELGIRIPRPLGQGPSRFIPEKEILQVGSEDAQMHALFADSFAALGRLD

• Full Name: sestrin 1
• Calculated Molecular Weight: 551 aa, 64 kDa
• Observed Molecular Weight: 57-66 kDa
• GenBank Accession Number: BC112036
• Gene Symbol: SESN1
• Gene ID (NCBI): 27244
• RRID: AB_10793724
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6P5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sestrins, including sestrin-1 (PA26), sestrin-2 (Hi95), and sestrin-3, are 48 to 65 kDa cystein sulfinyl reductases and they modulate peroxide signaling and antioxidant defense. These proteins selectively reduce or repair hyperoxidized forms of typical 2-Cys peroxiredoxins within eukaryotes. Expression of these proteins is regulated by p53, a tumor suppressor protein. Sestrin 1 is implicated in the inhibition of cell growth. It is approximately a 66kDa protein in humans (551 amino acids).

Publications

What published studies show

Sestrin2 (SESN2) antibody, catalog number 21668-1-AP, has 27 citations published in journals including Nature, Science, Molecular Cell, EMBO Journal, PNAS, Cell Reports, Diabetes, Osteoarthritis and Cartilage, and Biochimica et Biophysica Acta. Research fields span mTORC1 nutrient sensing, amino acid metabolism (leucine/glutamine), exercise physiology and muscle anabolism, cancer, autophagy, mitochondrial function, and neuroprotection.

Automatically generated from the 27 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; SAR1B senses leucine levels to regulate mTORC1 signalling.; Authors - Jie Chen
mouse	WB	Science; Zonated leucine sensing by Sestrin-mTORC1 in the liver controls the response to dietary leucine.; Authors - Andrew L Cangelosi
human	WB	Mol Cell; Ring domains are essential for GATOR2-dependent mTORC1 activation; Authors - Cong Jiang
	WB	J Hazard Mater; Lithium with environmentally relevant concentrations interferes with mitochondrial function, antioxidant response, and autophagy processes in Daphnia magna, leading to changes in life-history traits and behavior; Authors - Chunni Duan
human	WB	Proc Natl Acad Sci U S A; Rag-Ragulator is the central organizer of the physical architecture of the mTORC1 nutrient-sensing pathway; Authors - Max L Valenstein
		Diabetes; PMID: 25377878; Authors - Rongya Tao