SETD5 Polyclonal antibody

• 

  WB analysis using 28434-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 28434-1-AP (SETD5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of BxPC-3 using 28434-1-AP

  IP result of anti-SETD5 (IP:28434-1-AP, 4ug; Detection:28434-1-AP 1:600) with BxPC-3 cells lysate 2360 ug.

SETD5 Polyclonal Antibody for WB, IP, ELISA

Cat No. 28434-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

KIAA1757, Histone-lysine N-methyltransferase SETD5

---

Tested Applications

• Positive WB detected in: HEK-293T cells
• Positive IP detected in: BxPC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28434-1-AP targets SETD5 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28920

  Product name: Recombinant human SETD5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-202 aa of BC020956

  Sequence: MHAFENLEKRKKRRDQPLEQSNSDVEITTTTSETPVGEETKTEAPESEVSNSVSNVTIPSTPQSVGVNTRRSSQAGDIAAEKLVPKPPPAKPSRPRPKSRISRYRTSSAQRLKRQKQANAQQAELSQAALEEGGSNSLVTPTEAGSLDSSGENRPLTGSDPTVVSITGSHVNRAASKYPKTKKYLVTEWLNDKAEKQECPVE

• Full Name: SET domain containing 5
• Observed Molecular Weight: 160-220 kDa
• GenBank Accession Number: BC020956
• Gene Symbol: SETD5
• Gene ID (NCBI): 55209
• RRID: AB_3669659
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9C0A6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SETD5, also known as KIAA1757, is a member of the histone lysine methyltransferase family. It has 3 isoforms and is involved in a variety of cellular functions, including cell cycle regulation and cell proliferation, and has a potential role in early embryonic development (PMID: 36875494).