SF3B4 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 85663-3-PBS

  Biolayer interferometry (BLl) kinetic assays of 85663-3-PBS against Human SF3B4 was performed. The affinity constant is 2.59 nM.

SF3B4 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 85663-3-PBS

Clone No.243098E9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

Pre-mRNA-splicing factor SF3b 49 kDa subunit, SAP 49, SAP49, SF3b49, SF3b50

---

Product Information

85663-3-PBS targets SF3B4 in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0737

  Product name: Recombinant human SF3B4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC004273

  Sequence: MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNP

• Full Name: splicing factor 3b, subunit 4, 49kDa
• Calculated Molecular Weight: 44 aa, 3 kDa
• GenBank Accession Number: BC004273
• Gene Symbol: SF3B4
• Gene ID (NCBI): 10262
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15427
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.