SFRS15 Polyclonal antibody

• 

  WB analysis using 33589-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33589-1-AP (SFRS15 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

SFRS15 Polyclonal Antibody for WB, ELISA

Cat No. 33589-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CTD-binding SR-like protein RA4, KIAA1172, SCAF4, Splicing factor, arginine/serine-rich 15, SR-related and CTD-associated factor 4

---

Tested Applications

• Positive WB detected in: HEK-293T cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33589-1-AP targets SFRS15 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37951

  Product name: Recombinant human SFRS15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 991-1147 aa of BC064990

  Sequence: FNSGRDQERFGRRSFGNRVENDRERYGNRNDDRDNSNRDRREWGRRSPDRDRHRDLEERNRRSSGHRDRERDSRDRESRREKEEARGKEKPEVTDRAGGNKTVEPPISQVGNVDTASELEKGVSEAAVLKPSEELPAEATSSVEPEKDSGSAAEAPR

• Full Name: splicing factor, arginine/serine-rich 15
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC064990
• Gene Symbol: SFRS15
• Gene ID (NCBI): 57466
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O95104
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SCAF4 is an mRNA anti-terminator protein that plays a crucial role in regulating transcription by RNA Polymerase II. It functions by binding to the phosphorylated CTD of Pol II and interacting with splicing factors to suppress premature transcription termination, particularly at genes with complex structures. This activity ensures proper transcriptional readthrough and full-length mRNA production, thereby influencing gene expression critical for cellular homeostasis. Dysregulation of SCAF4-mediated anti-termination is implicated in disrupted mRNA processing and potential disease states.