SFRS7 Polyclonal antibody

• 

  WB analysis using 11044-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11044-1-AP (SFRS7 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 11044-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 11044-1-AP (SFRS7 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat testis using 11044-1-AP

  rat testis tissue were subjected to SDS PAGE followed by western blot with 11044-1-AP (SFRS7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 11044-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11044-1-AP (SFRS7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 11044-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11044-1-AP (SFRS7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 11044-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SFRS7 antibody (11044-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

SFRS7 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11044-1-AP

Publications(11)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

AAG3, Serine/arginine-rich splicing factor 7, Splicing factor, arginine/serine-rich 7, SRSF7

---

Tested Applications

• Positive WB detected in: A549 cells, mouse testis tissue, rat testis tissue, HeLa cells, HepG2 cells, SKOV-3 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 6 publications below
• WB: See 10 publications below
• IHC: See 1 publications below
• IF: See 1 publications below
• IP: See 1 publications below

Product Information

11044-1-AP targets SFRS7 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1526

  Product name: Recombinant human SFRS7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-238 aa of BC000997

  Sequence: MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD

• Full Name: splicing factor, arginine/serine-rich 7, 35kDa
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC000997
• Gene Symbol: SFRS7
• Gene ID (NCBI): 6432
• RRID: AB_2185229
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16629
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SFRS7 is a member of the serine/arginine (SR) splicing factor family, which mediated the alternative splicing events target the resulting mRNAs for degradation by means of an RNA surveillance pathway called nonsense-mediated mRNA decay. It was found to repress the splicing of MAPT/Tau exon 10

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Gastroenterology; Proteomic characterization identifies clinically relevant subgroups of gastrointestinal stromal tumors; Authors - Mingjun Sun
human	WB	Cell; C9orf72 Dipeptide Repeats Impair the Assembly, Dynamics, and Function of Membrane-Less Organelles.; Authors - Kyung-Ha Lee
human	WB	Nucleic Acids Res; Sequence-dependent recruitment of SRSF1 and SRSF7 to intronless lncRNA NKILA promotes nuclear export via the TREX/TAP pathway.; Authors - Misbah Khan ; KD Validated
human	WB	Nucleic Acids Res; Exonic splicing code and protein binding sites for calcium.; Authors - Reuben J Pengelly ; KD Validated
human	WB	Genomics Proteomics Bioinformatics; Specific Regulation of m6A by SRSF7 Promotes the Progression of Glioblastoma.; Authors - Yixian Cun ; KD Validated
human	WB,IP	J Biol Chem; Proteomic study identifies Aurora-A mediated regulation of alternative splicing through multiple splicing factors; Authors - Arun Prasath Damodaran

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Madison (Verified Customer) (07-24-2025)

The antibody stained well with little background interference and overall showed a nice and noticeable pattern within the tissue and between the control and AD tissues.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: Human tissue positive for Alzheimer's Disease

FH

Jingwen (Verified Customer) (04-28-2021)

The staining signal showed up inside the nucleus.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:150
• Cell Tissue Type: Human cancer cell line