Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells |
| Positive IHC detected in | mouse kidney tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:400 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 12 publications below |
| IHC | See 1 publications below |
| IF | See 2 publications below |
| CoIP | See 1 publications below |
Product Information
28454-1-AP targets SGK1 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29420 Product name: Recombinant human SGK1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-82 aa of BC001263 Sequence: MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQ Predict reactive species |
| Full Name | serum/glucocorticoid regulated kinase 1 |
| Calculated Molecular Weight | 431 aa, 49 kDa |
| Observed Molecular Weight | 42-50 kDa |
| GenBank Accession Number | BC001263 |
| Gene Symbol | SGK1 |
| Gene ID (NCBI) | 6446 |
| RRID | AB_2881145 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00141 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Serum- and glucocorticoid-induced kinase 1 (SGK1),also named as SGK, is a S/T protein kinase that belongs to the AGC (cAMP-dependent, cGMP-dependent, and protein kinase C) kinase family. It is expressed in many cell types and participates in numerous cellular processes and it is ubiquitinated and degraded at the ER membrane(PMID: 16847254). The N-terminal motif of SGK1 is critical for its ubiquitination and degradation(PMID:16817852 ). SGK and Akt are likely to phosphorylate related substrates, as they share a similar consensus phosphorylation site (RXRXXS/T)(PMID:11154281). It has 5 isoforms produced by alternative promoter usage and alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SGK1 antibody 28454-1-AP | Download protocol |
| IHC protocol for SGK1 antibody 28454-1-AP | Download protocol |
| WB protocol for SGK1 antibody 28454-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Biol Chem SGK1 negatively regulates inflammatory immune responses and protects against alveolar bone loss through modulation of TRAF3 activity.
| ||
Cell Death Dis CircSEC24B activates autophagy and induces chemoresistance of colorectal cancer via OTUB1-mediated deubiquitination of SRPX2 | ||
Front Oncol Modeling of senescence-related chemoresistance in ovarian cancer using data analysis and patient-derived organoids | ||
Cell Death Dis Tumor exosomal circPTBP3 drives gastric cancer peritoneal metastasis via mesothelial-mesenchymal transition | ||
J Ethnopharmacol Huangkui capsule, an extract from Abelmoschus manihot (L.) medic, inhibits adrenal aldosterone synthesis and renal ERK/EGR1 pathway in the treatment of diabetic kidney disease | ||
J Transl Med Around-the-clock noise exposure induces hippocampus apoptosis and subsequent cognitive impairment via the PI3K/SGK1/Foxo3 signaling pathway |















