SGK1 Polyclonal antibody

• 

  WB analysis using 28454-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28454-1-AP (SGK1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 28454-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 28454-1-AP (SGK1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 28454-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 28454-1-AP (SGK1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 28454-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28454-1-AP (SGK1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 28454-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28454-1-AP (SGK1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 28454-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SGK1 antibody (28454-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HepG2 using 28454-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SGK1 antibody (28454-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of SH-SY5Y using 28454-1-AP

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using SGK1 antibody (28454-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

SGK1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 28454-1-AP

Publications(10)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

SGK, Serum/glucocorticoid-regulated kinase 1, Serine/threonine-protein kinase Sgk1, EC:2.7.11.1

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells
• Positive IHC detected in: mouse kidney tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 10 publications below

Product Information

28454-1-AP targets SGK1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29420

  Product name: Recombinant human SGK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-82 aa of BC001263

  Sequence: MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQ

• Full Name: serum/glucocorticoid regulated kinase 1
• Calculated Molecular Weight: 431 aa, 49 kDa
• Observed Molecular Weight: 42-50 kDa
• GenBank Accession Number: BC001263
• Gene Symbol: SGK1
• Gene ID (NCBI): 6446
• RRID: AB_2881145
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00141
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Serum- and glucocorticoid-induced kinase 1 (SGK1),also named as SGK, is a S/T protein kinase that belongs to the AGC (cAMP-dependent, cGMP-dependent, and protein kinase C) kinase family. It is expressed in many cell types and participates in numerous cellular processes and it is ubiquitinated and degraded at the ER membrane(PMID: 16847254). The N-terminal motif of SGK1 is critical for its ubiquitination and degradation(PMID:16817852 ). SGK and Akt are likely to phosphorylate related substrates, as they share a similar consensus phosphorylation site (RXRXXS/T)(PMID:11154281). It has 5 isoforms produced by alternative promoter usage and alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	J Biol Chem; SGK1 negatively regulates inflammatory immune responses and protects against alveolar bone loss through modulation of TRAF3 activity.; Authors - Xiao Han ; KD Validated
human	WB	Int J Mol Sci; PEBP4 Directs the Malignant Behavior of Hepatocellular Carcinoma Cells via Regulating mTORC1 and mTORC2; Authors - Qiongfeng Chen
human	WB	Front Oncol; Modeling of senescence-related chemoresistance in ovarian cancer using data analysis and patient-derived organoids; Authors - Xintong Cai
mouse	WB	Int J Biol Sci; Sodium chloride promotes macrophage pyroptosis and aggravates rheumatoid arthritis by activating SGK1 through GABA receptors Slc6a12; Authors - Xianzheng Zhang
human	WB	Cell Death Dis; CircSEC24B activates autophagy and induces chemoresistance of colorectal cancer via OTUB1-mediated deubiquitination of SRPX2; Authors - Di Wang
human	WB	Iran J Basic Med Sci; Quercetin is a foe in the heart by targeting the hERG potassium channel; Authors - Zihao Lu