Product Information
28683-1-PBS targets SGLT2 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag30120 Product name: Recombinant human SLC5A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 222-285 aa of BC131542 Sequence: EVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTI Predict reactive species |
Full Name | solute carrier family 5 (sodium/glucose cotransporter), member 2 |
Calculated Molecular Weight | 672 aa, 73 kDa |
Observed Molecular Weight | 73 kDa |
GenBank Accession Number | BC131542 |
Gene Symbol | SGLT2 |
Gene ID (NCBI) | 6524 |
RRID | AB_2918190 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P31639 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
Sodium-glucose cotransporter 2 (SGLT2), encoded by SLC5A2, utilizes the electrochemical sodium gradient to transport glucose against the cell's internal concentration gradient. Mainly expressed on brush border membrane (BBM) of epithelial cells in the early segment of the proximal tubule, SGLT2 mediates most of the glucose reabsorption by the kidney overall. Inhibition of SGLT2 could improve glucose homeostasis of diabetic patients, which has been considered as a novel strategy for diabetes treatment.