SH2D1A Polyclonal antibody, PBS Only

• 

  WB analysis of mouse thymus using 11868-1-AP (same clone as 11868-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 11868-1-AP (SH2D1A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11868-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 11868-1-AP (same clone as 11868-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 11868-1-AP (SH2D1A Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11868-1-PBS in a different storage buffer formulation.

SH2D1A Polyclonal Antibody for WB, Indirect ELISA

Cat No. 11868-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

11868-1-PBS targets SH2D1A in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2450

  Product name: Recombinant human SH2D1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-128 aa of BC020732

  Sequence: MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP

• Full Name: SH2 domain protein 1A
• Calculated Molecular Weight: 128 aa, 14 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC020732
• Gene Symbol: SH2D1A
• Gene ID (NCBI): 4068
• RRID: AB_2239283
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60880
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SH2D1A, also named as DSHP and SAP, is an inhibitor of the SLAM self-association. It acts by blocking recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to a docking site in the SLAM cytoplasmic region. SH2D1A mediates interaction between FYN and SLAMF1. Defects in SH2D1A are a cause of lymphoproliferative syndrome X-linked type 1 (XLP1).