Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27272-1-AP targets SHANK2 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26101 Product name: Recombinant human SHANK2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 381-490 aa of NM_012309 Sequence: VDKASVRKKKDKPEEIVPASKPSRAAENMAVEPRVATIKQRPSSRCFPAGSDMNSVYERQGIAVMTPTVPGSPKAPFLGIPRGTMRRQKSIDSRIFLSGITEEERQFLAP Predict reactive species |
| Full Name | SH3 and multiple ankyrin repeat domains 2 |
| Calculated Molecular Weight | 159 kDa |
| Observed Molecular Weight | 158-200 kDa |
| GenBank Accession Number | NM_012309 |
| Gene Symbol | SHANK2 |
| Gene ID (NCBI) | 22941 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UPX8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SH3 and multiple ankyrin repeat domains protein 2 (SHANK2) is also named as CORTBP1, KIAA1022, PROSAP1. SHANK2 code a scaffolding protein located at the postsynaptic membrane of glutamatergic neurons (PMID: 32987185). SHANK2 encodes for a postsynaptic scaffolding protein at glutamatergic synapses in the brain, essential for proper synapse formation, development and plasticity (PMID: 11283303, PMID: 12065602). As SHANK2 directly interacts with IRSp53 (insulin receptor substrate p53), it may be involved in insulin signaling in the brain, making this pathway susceptible to SHANK2 mutations (PMID: 33483523). In the SFARI gene database, SHANK2 is categorized as a high confidence autism risk gene. In addition, SHANK2 has been linked to the pathology of neuropsychiatric (schizophrenia, bipolar disorder) and neurodegenerative disorders (PMID: 33483523).
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for SHANK2 antibody 27272-1-AP | Download protocol |
| WB protocol for SHANK2 antibody 27272-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



