SHF Polyclonal antibody, PBS Only

• 

  WB analysis using 21909-1-AP (same clone as 21909-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21909-1-AP (SHF antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21909-1-PBS in a different storage buffer formulation.

SHF Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21909-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

21909-1-PBS targets SHF in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15083

  Product name: Recombinant human SHF protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-184 aa of BC101601

  Sequence: MEPYEAQKMMAEIRGSKETATQPLPLYDTPYEPEEDGATPEGEGAPWPRESRLPEDDERPPEEYDQPWEWKKERISKAFAVDIKVIKDLPWPPPVGQLDSSPSLPDGDRDISGPASPLPEPSLEDSSAQFEGPEKSCLSPGREEKGRLPPRLSAGNPKSAKPLSMEPSSPLGEWTDPALPLENQ

• Full Name: Src homology 2 domain containing F
• Calculated Molecular Weight: 480 aa, 53 kDa
• Observed Molecular Weight: 46-50 kDa
• GenBank Accession Number: BC101601
• Gene Symbol: SHF
• Gene ID (NCBI): 90525
• RRID: AB_11182725
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: B3KTY1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.