SHLD3 Polyclonal antibody, PBS Only

SHLD3 Polyclonal Antibody for WB, Indirect ELISA
Cat No. 30735-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

FLJ26957, REV7-interacting novel NHEJ regulator 1, RINN1, Shield complex subunit 3, Shieldin complex subunit 3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

30735-1-PBS targets SHLD3 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag32940

Product name: Recombinant human SHLD3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-250 aa of

Sequence: MTTEVILHYRPCESDPTQLPKIAEKAIQDFPTRPLSRFIPWFPYDGSKLPLRPKRSPPVISEEAAEDVKQYLTISEHDAKSHSYDCTVDLLEFQPSLKKQHLTWSHTLKEQTNSGNLGKQSEKGKQHKRRSWSISLPSNNCTKNVSPLSKKLQDSLKALNLHSLYRARWTIEHTICNSQTLEDIWTKLNQIIRHNELPSCNATIQRHLGQIWVFCDIMYCEYVGSLLKGRLALTGKINLFVHKYGVIFSM

Predict reactive species
Full Name SHLD3
Calculated Molecular Weight29 kDa
Observed Molecular Weight28-70 kDa
Gene Symbol SHLD3
Gene ID (NCBI) 112441434
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ6ZNX1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SHLD3 (shieldin complex subunit 3), also known as RINN1 or CTC-534A2.2. It is located in Chromosome and expressed in monocyte. The gene is a component of the shieldin complex, which plays an important role in repair of DNA double-stranded breaks (DSBs). It has been found that the proper function of MAD2L2 in shieldin requires its dimerization, and the interaction between MAD2L2 and SHLD3 is mediated and accelerated by SHLD2. The dimerization defect MAD2L2 damages the assembly of shieldin and cannot promote the NHEJ. In addition, the dimerization of MAD2L2 and the existence of SHLD3 allow shieldin to interact with TRIP13 ATPase (PMID: 34521823). The calculated molecular weight of SHLD3 is 28 kDa, the antibody can recognize the 70kDa band, which may be related to the interaction between MAD2L2 and SHLD3 as a dimer in shieldin complex.

Loading...
||
New chat Able
正在加载,请稍候...