SIGIRR Monoclonal antibody, PBS Only (Detector)

SIGIRR Monoclonal Antibody for Cytometric bead array, Indirect ELISA
Cat No. 61011-2-PBS
Clone No.2A8D2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Single Ig IL-1-related receptor, Single Ig IL-1R-related molecule, Single immunoglobulin domain-containing IL1R-related protein, TIR8, Toll/interleukin 1 receptor 8

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

61011-2-PBS targets SIGIRR as part of a matched antibody pair:

MP51473-1: 61011-1-PBS capture and 61011-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag32814

Product name: Recombinant human SIGIRR protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-118 aa of BC025953

Sequence: MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWVKANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSH

Predict reactive species
Full Name single immunoglobulin and toll-interleukin 1 receptor (TIR) domain
Calculated Molecular Weight 46 kDa
GenBank Accession NumberBC025953
Gene Symbol SIGIRR
Gene ID (NCBI) 59307
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G Magarose purification
UNIPROT IDQ6IA17
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SIGIRR (also known as TIR8) is a member of the toll-like receptor (TLR)/interleukin 1 receptor (IL-1R) superfamily, with a single immunoglobulin extracellular domain and a TIR (Toll/IL-1R) intracellular domain. SIGIRR functions as a negative regulator for IL-1 and LPS signaling, through its interaction with the TLR4 and IL-1R complex. SIGIRR is an important modulator of intestinal epithelial homeostasis and a key regulator of mucosal immunity, maintaining microbial tolerance of the intestinal epithelial layer (PMID: 17398123). The molecular weight of the glycosylated SIGIRR was found to be in the range 50-80 kDa (PMID: 10346978; 17495864).

Loading...
||
New chat

Able

正在加载,请稍候...