Siglec-9 Polyclonal antibody

• 

  WB analysis of HL-60 using 13377-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 13377-1-AP (Siglec-9 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 13377-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 13377-1-AP (Siglec-9 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U-937 using 13377-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 13377-1-AP (Siglec-9 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A375 using 13377-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 13377-1-AP (Siglec-9 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 13377-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13377-1-AP (Siglec-9 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 13377-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13377-1-AP (Siglec-9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human tonsillitis using 13377-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using Siglec-9 antibody (13377-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Siglec-9 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 13377-1-AP

Publications(2)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

SIGLEC9, CD329, Protein FOAP 9, Sialic acid-binding Ig-like lectin 9, Siglec 9

---

Tested Applications

• Positive WB detected in: HL-60 cells, U-937 cells, mouse skeletal muscle tissue, A375 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Western Blot (WB): WB : 1:300-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below
• IF: See 2 publications below

Product Information

13377-1-AP targets Siglec-9 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4201

  Product name: Recombinant human SIGLEC9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 211-341 aa of BC035365

  Sequence: LTCQVTFPGASVTTNKTVHLNVSYPPQNLTMTVFQGDGTVSTVLGNGSSLSLPEGQSLRLVCAVDAVDSNPPARLSLSWRGLTLCPSQPSNPGVLELPWVHLRDEAEFTCRAQNPLGSQQVYLNVSLQSKA

• Full Name: sialic acid binding Ig-like lectin 9
• Calculated Molecular Weight: 463 aa, 50 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC035365
• Gene Symbol: Siglec-9
• Gene ID (NCBI): 27180
• RRID: AB_2187293
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y336
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sialic acid binding Ig-like lectin 9 (Siglec-9), also known as CD329, is a member of the Siglec family of glycan-recognition proteins. Siglec-9 is a type-I transmembrane protein consisting of an N-terminal extracellular region that contains an N-terminal V-set domain and two C2-set domains, a transmembrane region, and an intracellular domain with an immunoreceptor tyrosine-based inhibitory motif (ITIM) and an ITIM-like motif (PMID: 10801862). It is expressed quite broadly among human blood leukocytes, including monocytes, neutrophils, B cells, NK cells, and minor subsets of T cells (PMID: 32322597). Siglec-9 functions as an inhibitory immune checkpoint and can be targeted to enhance therapeutic antitumor immunity (PMID: 34155121; 37460871).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Nat Cancer; Siglec-9 acts as an immune-checkpoint molecule on macrophages in glioblastoma, restricting T-cell priming and immunotherapy response; Authors - Yan Mei
human	WB,IHC,IF	Commun Biol; ST3 beta-galactoside alpha-2,3-sialyltransferase 1 (ST3Gal1) synthesis of Siglec ligands mediates anti-tumour immunity in prostate cancer; Authors - Rebecca Garnham

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Emma (Verified Customer) (11-29-2021)

Works well by IF on FFPE tissue. Antigen retrieval Tris-EDTA pH 9.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:25
• Cell Tissue Type: Prostate